Cp4.1LG08g00650 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCGGCGGAGAGAGAGGAGGGCGGCAACCCCCCGCCGCCGTGCCGAGAGGGTGTTTGGCGGTGAAGGTGGGGCAGAGAGGGGAAAAGCAGCAGAGATTTGTGGTGCCGGTGATGTACTTCAACCACCCGCGGTTCATGCAACTGCTGAAAGAGGCGGAGGAGGAGTACGGTTTTGATCAGAAGGGGACTATCACCATTCCTTGCCACGTGGAGGAGTTTAGACACGTGCAGTGCATGATTGACCGGGAAAACTCCTTTCACCGCCGTCATCACCACCACCAACTCCACCACCACCTCGGTTGCTTTCGGGTTTCATTCTAA ATGGGCGGCGGAGAGAGAGGAGGGCGGCAACCCCCCGCCGCCGTGCCGAGAGGGTGTTTGGCGGTGAAGGTGGGGCAGAGAGGGGAAAAGCAGCAGAGATTTGTGGTGCCGGTGATGTACTTCAACCACCCGCGGTTCATGCAACTGCTGAAAGAGGCGGAGGAGGAGTACGGTTTTGATCAGAAGGGGACTATCACCATTCCTTGCCACGTGGAGGAGTTTAGACACGTGCAGTGCATGATTGACCGGGAAAACTCCTTTCACCGCCGTCATCACCACCACCAACTCCACCACCACCTCGGTTGCTTTCGGGTTTCATTCTAA ATGGGCGGCGGAGAGAGAGGAGGGCGGCAACCCCCCGCCGCCGTGCCGAGAGGGTGTTTGGCGGTGAAGGTGGGGCAGAGAGGGGAAAAGCAGCAGAGATTTGTGGTGCCGGTGATGTACTTCAACCACCCGCGGTTCATGCAACTGCTGAAAGAGGCGGAGGAGGAGTACGGTTTTGATCAGAAGGGGACTATCACCATTCCTTGCCACGTGGAGGAGTTTAGACACGTGCAGTGCATGATTGACCGGGAAAACTCCTTTCACCGCCGTCATCACCACCACCAACTCCACCACCACCTCGGTTGCTTTCGGGTTTCATTCTAA MGGGERGGRQPPAAVPRGCLAVKVGQRGEKQQRFVVPVMYFNHPRFMQLLKEAEEEYGFDQKGTITIPCHVEEFRHVQCMIDRENSFHRRHHHHQLHHHLGCFRVSF
BLAST of Cp4.1LG08g00650 vs. Swiss-Prot
Match: SAU32_ARATH (Auxin-responsive protein SAUR32 OS=Arabidopsis thaliana GN=SAUR32 PE=2 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 2.0e-33 Identity = 67/97 (69.07%), Postives = 80/97 (82.47%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. Swiss-Prot
Match: SAU36_ARATH (Auxin-responsive protein SAUR36 OS=Arabidopsis thaliana GN=SAUR36 PE=2 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.0e-13 Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. Swiss-Prot
Match: SAU15_ARATH (Auxin-responsive protein SAUR15 OS=Arabidopsis thaliana GN=SAUR15 PE=2 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 2.0e-12 Identity = 35/74 (47.30%), Postives = 49/74 (66.22%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. Swiss-Prot
Match: AXX15_SOYBN (Auxin-induced protein X15 OS=Glycine max PE=2 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.7e-11 Identity = 34/68 (50.00%), Postives = 45/68 (66.18%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. Swiss-Prot
Match: A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.4e-10 Identity = 33/64 (51.56%), Postives = 43/64 (67.19%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. TrEMBL
Match: A0A0A0L5S7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G118740 PE=4 SV=1) HSP 1 Score: 188.7 bits (478), Expect = 3.6e-45 Identity = 96/112 (85.71%), Postives = 99/112 (88.39%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. TrEMBL
Match: M5X0E8_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa010986mg PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 4.9e-34 Identity = 78/104 (75.00%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. TrEMBL
Match: A0A0D2SYI3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G128100 PE=4 SV=1) HSP 1 Score: 151.0 bits (380), Expect = 8.3e-34 Identity = 70/98 (71.43%), Postives = 82/98 (83.67%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. TrEMBL
Match: A0A0D2QRQ4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G044200 PE=4 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 7.0e-33 Identity = 71/98 (72.45%), Postives = 85/98 (86.73%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. TrEMBL
Match: W9QMN2_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_002582 PE=4 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 7.0e-33 Identity = 69/91 (75.82%), Postives = 77/91 (84.62%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. TAIR10
Match: AT2G46690.1 (AT2G46690.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 142.9 bits (359), Expect = 1.1e-34 Identity = 67/97 (69.07%), Postives = 80/97 (82.47%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. TAIR10
Match: AT4G00880.1 (AT4G00880.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 133.7 bits (335), Expect = 7.0e-32 Identity = 68/96 (70.83%), Postives = 78/96 (81.25%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. TAIR10
Match: AT3G61900.1 (AT3G61900.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 124.0 bits (310), Expect = 5.5e-29 Identity = 56/72 (77.78%), Postives = 65/72 (90.28%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. TAIR10
Match: AT5G53590.1 (AT5G53590.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 96.3 bits (238), Expect = 1.2e-20 Identity = 51/99 (51.52%), Postives = 68/99 (68.69%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. TAIR10
Match: AT3G60690.1 (AT3G60690.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 85.9 bits (211), Expect = 1.7e-17 Identity = 40/84 (47.62%), Postives = 57/84 (67.86%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. NCBI nr
Match: gi|449432006|ref|XP_004133791.1| (PREDICTED: auxin-induced protein X15-like [Cucumis sativus]) HSP 1 Score: 188.7 bits (478), Expect = 5.2e-45 Identity = 96/112 (85.71%), Postives = 99/112 (88.39%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. NCBI nr
Match: gi|694381053|ref|XP_009366624.1| (PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus x bretschneideri]) HSP 1 Score: 157.1 bits (396), Expect = 1.7e-35 Identity = 76/99 (76.77%), Postives = 84/99 (84.85%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. NCBI nr
Match: gi|658016243|ref|XP_008343461.1| (PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus domestica]) HSP 1 Score: 154.1 bits (388), Expect = 1.4e-34 Identity = 76/99 (76.77%), Postives = 84/99 (84.85%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. NCBI nr
Match: gi|645254527|ref|XP_008233080.1| (PREDICTED: auxin-induced protein 15A [Prunus mume]) HSP 1 Score: 151.8 bits (382), Expect = 7.0e-34 Identity = 78/104 (75.00%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cp4.1LG08g00650 vs. NCBI nr
Match: gi|596005129|ref|XP_007218348.1| (hypothetical protein PRUPE_ppa010986mg [Prunus persica]) HSP 1 Score: 151.8 bits (382), Expect = 7.0e-34 Identity = 78/104 (75.00%), Postives = 87/104 (83.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|