Csa3G118740 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.GATGGGAAGGCATAGACAAAGAGGGAGGGGGAGACCCACTTCCACTTTCTATGGTTTTTAATTCACTCCCAAATTCCTATATAACCAAACCCTAATTGGAACCCTTTCTCTCTCAACAAATCTAATTCTAATTAAAACCAAACACAGTCTCATGGCCATTCCCAATTACTCCCCCAATCCCACCTCGTTTTACGCTCTCACACTTCCTCCCTTCACTCCATCAGATCCCTGGCCTTTTCCCCATCTCTGAATTCAACTTCAAATTCCCCTCCAAATCCCTCTCTCTCCTTTTAATTCTCATATATCCTTTCAAATCACACGTACATATATACTTTATATATTTTATCGAGTCGTCGTAGAAATGGGCGGCGGAGAGAGACGACGGCAGTCCAGCGCCACCGTGCCGAAAGGGTGTTTGGCGGTGAAAGTGGGGCAGAAAGGGGAAGAGCAACAGAGATTTGTGGTGCCGGTGATGTATTTCAATCACCCGCGGTTCATGCAATTACTGAAGGAGGCAGAGGAAGAATACGGATTTGATCAGAAGGGGACCATCGCTATTCCTTGCCATGTGGAAGAGTTTCGGCACGTGCAAGGCATGATTGACCGTGAAAATTCATTCCACCGCCGTCATAACCACCACCACCACCAACAACAACACCACCACCACCACCTCGGTTGCTTTCGGGTTTCCTTCTAATCATCAACCTACACGATTAATAATAAAATTATGTATATTTCTCTCTTTATTTTAGGTCTTTTTTGGGAATATATTGCACTCTGTAATCCTAACAAAACTTCAATCTCTCTCTCTCTCTCTATATATATATATAT ATGGGCGGCGGAGAGAGACGACGGCAGTCCAGCGCCACCGTGCCGAAAGGGTGTTTGGCGGTGAAAGTGGGGCAGAAAGGGGAAGAGCAACAGAGATTTGTGGTGCCGGTGATGTATTTCAATCACCCGCGGTTCATGCAATTACTGAAGGAGGCAGAGGAAGAATACGGATTTGATCAGAAGGGGACCATCGCTATTCCTTGCCATGTGGAAGAGTTTCGGCACGTGCAAGGCATGATTGACCGTGAAAATTCATTCCACCGCCGTCATAACCACCACCACCACCAACAACAACACCACCACCACCACCTCGGTTGCTTTCGGGTTTCCTTCTAA ATGGGCGGCGGAGAGAGACGACGGCAGTCCAGCGCCACCGTGCCGAAAGGGTGTTTGGCGGTGAAAGTGGGGCAGAAAGGGGAAGAGCAACAGAGATTTGTGGTGCCGGTGATGTATTTCAATCACCCGCGGTTCATGCAATTACTGAAGGAGGCAGAGGAAGAATACGGATTTGATCAGAAGGGGACCATCGCTATTCCTTGCCATGTGGAAGAGTTTCGGCACGTGCAAGGCATGATTGACCGTGAAAATTCATTCCACCGCCGTCATAACCACCACCACCACCAACAACAACACCACCACCACCACCTCGGTTGCTTTCGGGTTTCCTTCTAA MGGGERRRQSSATVPKGCLAVKVGQKGEEQQRFVVPVMYFNHPRFMQLLKEAEEEYGFDQKGTIAIPCHVEEFRHVQGMIDRENSFHRRHNHHHHQQQHHHHHLGCFRVSF*
BLAST of Csa3G118740 vs. Swiss-Prot
Match: SAU32_ARATH (Auxin-responsive protein SAUR32 OS=Arabidopsis thaliana GN=SAUR32 PE=2 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 2.4e-37 Identity = 76/120 (63.33%), Postives = 88/120 (73.33%), Query Frame = 1
BLAST of Csa3G118740 vs. Swiss-Prot
Match: SAU36_ARATH (Auxin-responsive protein SAUR36 OS=Arabidopsis thaliana GN=SAUR36 PE=2 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 5.5e-13 Identity = 35/67 (52.24%), Postives = 45/67 (67.16%), Query Frame = 1
BLAST of Csa3G118740 vs. Swiss-Prot
Match: SAU15_ARATH (Auxin-responsive protein SAUR15 OS=Arabidopsis thaliana GN=SAUR15 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 7.9e-12 Identity = 36/75 (48.00%), Postives = 49/75 (65.33%), Query Frame = 1
BLAST of Csa3G118740 vs. Swiss-Prot
Match: AXX15_SOYBN (Auxin-induced protein X15 OS=Glycine max PE=2 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.5e-10 Identity = 34/74 (45.95%), Postives = 44/74 (59.46%), Query Frame = 1
BLAST of Csa3G118740 vs. Swiss-Prot
Match: AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.3e-10 Identity = 34/79 (43.04%), Postives = 46/79 (58.23%), Query Frame = 1
BLAST of Csa3G118740 vs. TrEMBL
Match: A0A0A0L5S7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G118740 PE=4 SV=1) HSP 1 Score: 243.4 bits (620), Expect = 1.3e-61 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 1
BLAST of Csa3G118740 vs. TrEMBL
Match: M5X0E8_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa010986mg PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.7e-37 Identity = 79/103 (76.70%), Postives = 86/103 (83.50%), Query Frame = 1
BLAST of Csa3G118740 vs. TrEMBL
Match: E5GCM6_CUCME (Auxin-responsive family protein OS=Cucumis melo subsp. melo PE=4 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 1.4e-36 Identity = 75/109 (68.81%), Postives = 88/109 (80.73%), Query Frame = 1
BLAST of Csa3G118740 vs. TrEMBL
Match: M5XL68_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa013301mg PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.9e-36 Identity = 76/96 (79.17%), Postives = 81/96 (84.38%), Query Frame = 1
BLAST of Csa3G118740 vs. TrEMBL
Match: A0A0D2SYI3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G128100 PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.9e-36 Identity = 74/102 (72.55%), Postives = 84/102 (82.35%), Query Frame = 1
BLAST of Csa3G118740 vs. TAIR10
Match: AT2G46690.1 (AT2G46690.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 156.0 bits (393), Expect = 1.4e-38 Identity = 76/120 (63.33%), Postives = 88/120 (73.33%), Query Frame = 1
BLAST of Csa3G118740 vs. TAIR10
Match: AT4G00880.1 (AT4G00880.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 146.4 bits (368), Expect = 1.1e-35 Identity = 73/99 (73.74%), Postives = 79/99 (79.80%), Query Frame = 1
BLAST of Csa3G118740 vs. TAIR10
Match: AT3G61900.1 (AT3G61900.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 125.6 bits (314), Expect = 2.0e-29 Identity = 58/72 (80.56%), Postives = 62/72 (86.11%), Query Frame = 1
BLAST of Csa3G118740 vs. TAIR10
Match: AT5G53590.1 (AT5G53590.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 113.2 bits (282), Expect = 1.0e-25 Identity = 53/99 (53.54%), Postives = 69/99 (69.70%), Query Frame = 1
BLAST of Csa3G118740 vs. TAIR10
Match: AT3G60690.1 (AT3G60690.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 85.1 bits (209), Expect = 3.0e-17 Identity = 41/84 (48.81%), Postives = 54/84 (64.29%), Query Frame = 1
BLAST of Csa3G118740 vs. NCBI nr
Match: gi|449432006|ref|XP_004133791.1| (PREDICTED: auxin-induced protein X15-like [Cucumis sativus]) HSP 1 Score: 243.4 bits (620), Expect = 1.8e-61 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 1
BLAST of Csa3G118740 vs. NCBI nr
Match: gi|694381053|ref|XP_009366624.1| (PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Pyrus x bretschneideri]) HSP 1 Score: 166.4 bits (420), Expect = 2.9e-38 Identity = 80/103 (77.67%), Postives = 88/103 (85.44%), Query Frame = 1
BLAST of Csa3G118740 vs. NCBI nr
Match: gi|658016243|ref|XP_008343461.1| (PREDICTED: indole-3-acetic acid-induced protein ARG7-like [Malus domestica]) HSP 1 Score: 164.5 bits (415), Expect = 1.1e-37 Identity = 79/103 (76.70%), Postives = 87/103 (84.47%), Query Frame = 1
BLAST of Csa3G118740 vs. NCBI nr
Match: gi|645254527|ref|XP_008233080.1| (PREDICTED: auxin-induced protein 15A [Prunus mume]) HSP 1 Score: 163.3 bits (412), Expect = 2.4e-37 Identity = 79/103 (76.70%), Postives = 86/103 (83.50%), Query Frame = 1
BLAST of Csa3G118740 vs. NCBI nr
Match: gi|596005129|ref|XP_007218348.1| (hypothetical protein PRUPE_ppa010986mg [Prunus persica]) HSP 1 Score: 163.3 bits (412), Expect = 2.4e-37 Identity = 79/103 (76.70%), Postives = 86/103 (83.50%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|