Lsi06G012130 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGCTCGCATGCGTATGGGAAGAGAAAGAGCGAGAACTTGGACGGCAACAAGCGCCAGGAACTTGCCCTTTCTGTCAAGGCAAAGTGTACGCCATTGATGTCGAAAGGCGATGGAAGCTCTGTTTTCTTCCTCTCTGCCTGAAGATCAAGAGGAAGTATCTCTGTACTCTCTGTTCTCGCCGCCTTGAATTGTGCCACTGGTAG ATGTGGCTCGCATGCGTATGGGAAGAGAAAGAGCGAGAACTTGGACGGCAACAAGCGCCAGGAACTTGCCCTTTCTGTCAAGGCAAAGTGTACGCCATTGATGTCGAAAGGCGATGGAAGCTCTGTTTTCTTCCTCTCTGCCTGAAGATCAAGAGGAAGTATCTCTGTACTCTCTGTTCTCGCCGCCTTGAATTGTGCCACTGGTAG ATGTGGCTCGCATGCGTATGGGAAGAGAAAGAGCGAGAACTTGGACGGCAACAAGCGCCAGGAACTTGCCCTTTCTGTCAAGGCAAAGTGTACGCCATTGATGTCGAAAGGCGATGGAAGCTCTGTTTTCTTCCTCTCTGCCTGAAGATCAAGAGGAAGTATCTCTGTACTCTCTGTTCTCGCCGCCTTGAATTGTGCCACTGGTAG MWLACVWEEKERELGRQQAPGTCPFCQGKVYAIDVERRWKLCFLPLCLKIKRKYLCTLCSRRLELCHW
BLAST of Lsi06G012130 vs. TrEMBL
Match: A0A0A0LUS9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G426700 PE=4 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 6.2e-35 Identity = 66/68 (97.06%), Postives = 68/68 (100.00%), Query Frame = 1
BLAST of Lsi06G012130 vs. TrEMBL
Match: B9THU3_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1968200 PE=4 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 4.6e-22 Identity = 47/67 (70.15%), Postives = 57/67 (85.07%), Query Frame = 1
BLAST of Lsi06G012130 vs. TrEMBL
Match: A0A151RW15_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_031643 PE=4 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 4.6e-22 Identity = 45/65 (69.23%), Postives = 56/65 (86.15%), Query Frame = 1
BLAST of Lsi06G012130 vs. TrEMBL
Match: A0A067J9B5_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_06884 PE=4 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 7.9e-22 Identity = 46/67 (68.66%), Postives = 56/67 (83.58%), Query Frame = 1
BLAST of Lsi06G012130 vs. TrEMBL
Match: A0A0B2QSL0_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_032280 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.3e-21 Identity = 45/65 (69.23%), Postives = 57/65 (87.69%), Query Frame = 1
BLAST of Lsi06G012130 vs. TAIR10
Match: AT5G57123.1 (AT5G57123.1 unknown protein) HSP 1 Score: 101.7 bits (252), Expect = 1.9e-22 Identity = 43/67 (64.18%), Postives = 52/67 (77.61%), Query Frame = 1
BLAST of Lsi06G012130 vs. TAIR10
Match: AT4G29905.1 (AT4G29905.1 unknown protein) HSP 1 Score: 92.8 bits (229), Expect = 8.6e-20 Identity = 39/65 (60.00%), Postives = 48/65 (73.85%), Query Frame = 1
BLAST of Lsi06G012130 vs. TAIR10
Match: AT5G10695.1 (AT5G10695.1 unknown protein) HSP 1 Score: 73.9 bits (180), Expect = 4.2e-14 Identity = 30/63 (47.62%), Postives = 42/63 (66.67%), Query Frame = 1
BLAST of Lsi06G012130 vs. NCBI nr
Match: gi|449457203|ref|XP_004146338.1| (PREDICTED: uncharacterized protein LOC101203895 [Cucumis sativus]) HSP 1 Score: 154.1 bits (388), Expect = 9.0e-35 Identity = 66/68 (97.06%), Postives = 68/68 (100.00%), Query Frame = 1
BLAST of Lsi06G012130 vs. NCBI nr
Match: gi|657998311|ref|XP_008391556.1| (PREDICTED: uncharacterized protein LOC103453765 [Malus domestica]) HSP 1 Score: 113.6 bits (283), Expect = 1.3e-22 Identity = 50/65 (76.92%), Postives = 57/65 (87.69%), Query Frame = 1
BLAST of Lsi06G012130 vs. NCBI nr
Match: gi|1000936016|ref|XP_015584313.1| (PREDICTED: uncharacterized protein LOC8263837 [Ricinus communis]) HSP 1 Score: 111.3 bits (277), Expect = 6.7e-22 Identity = 47/67 (70.15%), Postives = 57/67 (85.07%), Query Frame = 1
BLAST of Lsi06G012130 vs. NCBI nr
Match: gi|1012335409|gb|KYP46739.1| (hypothetical protein KK1_031643 [Cajanus cajan]) HSP 1 Score: 111.3 bits (277), Expect = 6.7e-22 Identity = 45/65 (69.23%), Postives = 56/65 (86.15%), Query Frame = 1
BLAST of Lsi06G012130 vs. NCBI nr
Match: gi|802795960|ref|XP_012092640.1| (PREDICTED: uncharacterized protein LOC105650361 [Jatropha curcas]) HSP 1 Score: 110.5 bits (275), Expect = 1.1e-21 Identity = 46/67 (68.66%), Postives = 56/67 (83.58%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|