Csa5G175890 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTCAGAAACTTTTGTAGAAATCATTTTGGCAATTCTTCTTCCACCTCTTGGAGTTTTCCTTCGCTATGGCTGTGGGGTCTGATACCTTCAAACTCTGTTTCCTTTTTTCATTCATTTTACAAGAACAACCTTGTGTTTGATCTTCTCTCTCAATTTCGTGTTTGTTGATCAGTGTTTTTTCTTTTTTCTTTTTGTGGTCTTTTGATTTGCAAGTGCAGGTGGAGTTTTGGATTTGTTTGTTGCTGACCATTTTGGGATATATACCTGGAATTATATATGCAATTTATGTTCTTGTTGGATAA ATGGGTTCAGAAACTTTTGTAGAAATCATTTTGGCAATTCTTCTTCCACCTCTTGGAGTTTTCCTTCGCTATGGCTGTGGGGTGGAGTTTTGGATTTGTTTGTTGCTGACCATTTTGGGATATATACCTGGAATTATATATGCAATTTATGTTCTTGTTGGATAA ATGGGTTCAGAAACTTTTGTAGAAATCATTTTGGCAATTCTTCTTCCACCTCTTGGAGTTTTCCTTCGCTATGGCTGTGGGGTGGAGTTTTGGATTTGTTTGTTGCTGACCATTTTGGGATATATACCTGGAATTATATATGCAATTTATGTTCTTGTTGGATAA MGSETFVEIILAILLPPLGVFLRYGCGVEFWICLLLTILGYIPGIIYAIYVLVG*
BLAST of Csa5G175890 vs. Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 3.9e-20 Identity = 44/52 (84.62%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Csa5G175890 vs. Swiss-Prot
Match: LT02_HORVU (Low temperature-induced protein lt101.2 OS=Hordeum vulgare GN=LT101.2 PE=2 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.5e-19 Identity = 43/53 (81.13%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of Csa5G175890 vs. Swiss-Prot
Match: LT01_HORVU (Low temperature-induced protein lt101.1 OS=Hordeum vulgare GN=LT101.1 PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 3.3e-19 Identity = 44/53 (83.02%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of Csa5G175890 vs. Swiss-Prot
Match: ESI3_ELYEL (Salt stress-induced hydrophobic peptide ESI3 OS=Elymus elongatus GN=ESI3 PE=2 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 3.3e-19 Identity = 44/53 (83.02%), Postives = 47/53 (88.68%), Query Frame = 1
BLAST of Csa5G175890 vs. Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 8.0e-18 Identity = 37/52 (71.15%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Csa5G175890 vs. TrEMBL
Match: A0A0A0KRZ2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G175890 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 1.3e-22 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G175890 vs. TrEMBL
Match: Q941D7_ARATH (At2g38901/At2g38901 OS=Arabidopsis thaliana GN=At2g38905 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 6.4e-22 Identity = 52/54 (96.30%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G175890 vs. TrEMBL
Match: D7LCD2_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_482911 PE=4 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 6.4e-22 Identity = 52/54 (96.30%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G175890 vs. TrEMBL
Match: A0A067DNL4_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g038161mg PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 1.1e-21 Identity = 50/54 (92.59%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G175890 vs. TrEMBL
Match: V4T885_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10033283mg PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 1.1e-21 Identity = 50/54 (92.59%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G175890 vs. TAIR10
Match: AT2G38905.1 (AT2G38905.1 Low temperature and salt responsive protein family) HSP 1 Score: 110.5 bits (275), Expect = 3.2e-25 Identity = 52/54 (96.30%), Postives = 52/54 (96.30%), Query Frame = 1
BLAST of Csa5G175890 vs. TAIR10
Match: AT3G05880.1 (AT3G05880.1 Low temperature and salt responsive protein family) HSP 1 Score: 97.8 bits (242), Expect = 2.2e-21 Identity = 44/52 (84.62%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Csa5G175890 vs. TAIR10
Match: AT3G05890.1 (AT3G05890.1 Low temperature and salt responsive protein family) HSP 1 Score: 90.1 bits (222), Expect = 4.5e-19 Identity = 37/52 (71.15%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Csa5G175890 vs. TAIR10
Match: AT1G57550.1 (AT1G57550.1 Low temperature and salt responsive protein family) HSP 1 Score: 80.1 bits (196), Expect = 4.7e-16 Identity = 35/52 (67.31%), Postives = 43/52 (82.69%), Query Frame = 1
BLAST of Csa5G175890 vs. TAIR10
Match: AT4G30650.1 (AT4G30650.1 Low temperature and salt responsive protein family) HSP 1 Score: 76.3 bits (186), Expect = 6.8e-15 Identity = 38/51 (74.51%), Postives = 42/51 (82.35%), Query Frame = 1
BLAST of Csa5G175890 vs. NCBI nr
Match: gi|700195289|gb|KGN50466.1| (hypothetical protein Csa_5G175890 [Cucumis sativus]) HSP 1 Score: 112.8 bits (281), Expect = 1.9e-22 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G175890 vs. NCBI nr
Match: gi|778700767|ref|XP_004143609.2| (PREDICTED: uncharacterized protein LOC101203086 [Cucumis sativus]) HSP 1 Score: 112.8 bits (281), Expect = 1.9e-22 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G175890 vs. NCBI nr
Match: gi|659090136|ref|XP_008445856.1| (PREDICTED: low temperature-induced protein lt101.2 [Cucumis melo]) HSP 1 Score: 112.1 bits (279), Expect = 3.2e-22 Identity = 53/54 (98.15%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G175890 vs. NCBI nr
Match: gi|18404892|ref|NP_565897.1| (Low temperature and salt responsive protein [Arabidopsis thaliana]) HSP 1 Score: 110.5 bits (275), Expect = 9.2e-22 Identity = 52/54 (96.30%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G175890 vs. NCBI nr
Match: gi|567887380|ref|XP_006436212.1| (hypothetical protein CICLE_v10033283mg [Citrus clementina]) HSP 1 Score: 109.8 bits (273), Expect = 1.6e-21 Identity = 50/54 (92.59%), Postives = 54/54 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|