Cp4.1LG01g04360 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.AAACAGAGAGAGAATTATGGGTTCTGAAACTTTTGTAGAAATCATATTAGCAATTCTTCTTCCACCACTTGGAGTTTTCCTTCGCTATGGCTGTGGGGTGATGTCTCAATTCTTCTCTCCAAATTCTGTTTTCATTTTACAATATTTCTCTGTCTTTTCTTTCAAATTGTTTTTCTGATTGTGTTCTTGTTTTTGATTTGCAAGTGCAGGTAGAGTTTTGGATTTGTTTGTTGCTGACCATATTGGGATATATCCCTGGAATTATATATGCAATATATGTGCTGGTTGGTTAGAAAAGGAAGAAATTTGAAAGCCTAGTTTTAATGAATGCCTCTTTCTTATTTTGGTTTGTAGAAAGTTTGTGTGTTTATGGCTCTTGGATCTATGTTGTTGTAGAACACTGAATAGATATTATCATTTATTGGCTAGTCCTNAGTTTTGGATTTGTTTGTTGCTGACCATATTGGGATATATCCCTGGAATTATATATGCAATATATGTG AAACAGAGAGAGAATTATGGGTTCTGAAACTTTTGTAGAAATCATATTAGCAATTCTTCTTCCACCACTTGGAGTTTTCCTTCGCTATGGCTGTGGGGTAGAGTTTTGGATTTGTTTGTTGCTGACCATATTGGGATATATCCCTGGAATTATATATGCAATATATGTGCTGTTTTGGATTTGTTTGTTGCTGACCATATTGGGATATATCCCTGGAATTATATATGCAATATATGTG ATGGGTTCTGAAACTTTTGTAGAAATCATATTAGCAATTCTTCTTCCACCACTTGGAGTTTTCCTTCGCTATGGCTGTGGGGTAGAGTTTTGGATTTGTTTGTTGCTGACCATATTGGGATATATCCCTGGAATTATATATGCAATATATGTGCTGTTTTGGATTTGTTTGTTGCTGACCATATTGGGATATATCCCTGGAATTATATATGCAATATATGTG MGSETFVEIILAILLPPLGVFLRYGCGVEFWICLLLTILGYIPGIIYAIYVLFWICLLLTILGYIPGIIYAIYV
BLAST of Cp4.1LG01g04360 vs. Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 2.8e-18 Identity = 44/52 (84.62%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. Swiss-Prot
Match: LT02_HORVU (Low temperature-induced protein lt101.2 OS=Hordeum vulgare GN=LT101.2 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.1e-17 Identity = 42/52 (80.77%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. Swiss-Prot
Match: LT01_HORVU (Low temperature-induced protein lt101.1 OS=Hordeum vulgare GN=LT101.1 PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 7.0e-17 Identity = 43/52 (82.69%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. Swiss-Prot
Match: ESI3_ELYEL (Salt stress-induced hydrophobic peptide ESI3 OS=Elymus elongatus GN=ESI3 PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 7.0e-17 Identity = 43/52 (82.69%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 5.9e-16 Identity = 37/52 (71.15%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. TrEMBL
Match: A0A0A0KRZ2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G175890 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 1.4e-19 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. TrEMBL
Match: D7LCD2_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_482911 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 6.8e-19 Identity = 50/52 (96.15%), Postives = 52/52 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. TrEMBL
Match: Q941D7_ARATH (At2g38901/At2g38901 OS=Arabidopsis thaliana GN=At2g38905 PE=2 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 6.8e-19 Identity = 50/52 (96.15%), Postives = 52/52 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. TrEMBL
Match: A0A067DNL4_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g038161mg PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.2e-18 Identity = 48/52 (92.31%), Postives = 52/52 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. TrEMBL
Match: M4DKR4_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.2e-18 Identity = 48/52 (92.31%), Postives = 52/52 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. TAIR10
Match: AT2G38905.1 (AT2G38905.1 Low temperature and salt responsive protein family) HSP 1 Score: 100.9 bits (250), Expect = 3.5e-22 Identity = 50/52 (96.15%), Postives = 52/52 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. TAIR10
Match: AT3G05880.1 (AT3G05880.1 Low temperature and salt responsive protein family) HSP 1 Score: 92.0 bits (227), Expect = 1.6e-19 Identity = 44/52 (84.62%), Postives = 50/52 (96.15%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. TAIR10
Match: AT3G05890.1 (AT3G05890.1 Low temperature and salt responsive protein family) HSP 1 Score: 84.3 bits (207), Expect = 3.3e-17 Identity = 37/52 (71.15%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. TAIR10
Match: AT1G57550.1 (AT1G57550.1 Low temperature and salt responsive protein family) HSP 1 Score: 73.9 bits (180), Expect = 4.5e-14 Identity = 35/52 (67.31%), Postives = 45/52 (86.54%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. TAIR10
Match: AT4G30650.1 (AT4G30650.1 Low temperature and salt responsive protein family) HSP 1 Score: 68.6 bits (166), Expect = 1.9e-12 Identity = 37/50 (74.00%), Postives = 43/50 (86.00%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. NCBI nr
Match: gi|700195289|gb|KGN50466.1| (hypothetical protein Csa_5G175890 [Cucumis sativus]) HSP 1 Score: 103.2 bits (256), Expect = 2.0e-19 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. NCBI nr
Match: gi|778700767|ref|XP_004143609.2| (PREDICTED: uncharacterized protein LOC101203086 [Cucumis sativus]) HSP 1 Score: 103.2 bits (256), Expect = 2.0e-19 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. NCBI nr
Match: gi|659090136|ref|XP_008445856.1| (PREDICTED: low temperature-induced protein lt101.2 [Cucumis melo]) HSP 1 Score: 102.4 bits (254), Expect = 3.4e-19 Identity = 51/52 (98.08%), Postives = 52/52 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. NCBI nr
Match: gi|18404892|ref|NP_565897.1| (Low temperature and salt responsive protein [Arabidopsis thaliana]) HSP 1 Score: 100.9 bits (250), Expect = 9.8e-19 Identity = 50/52 (96.15%), Postives = 52/52 (100.00%), Query Frame = 1
BLAST of Cp4.1LG01g04360 vs. NCBI nr
Match: gi|567887380|ref|XP_006436212.1| (hypothetical protein CICLE_v10033283mg [Citrus clementina]) HSP 1 Score: 100.1 bits (248), Expect = 1.7e-18 Identity = 48/52 (92.31%), Postives = 52/52 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |