Csa2G338800 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.GACCTTCCGAATTCAAATCAGAATGGCGACCACAGCTTGTTTCATCATCGTCAGTAGGAATAATATCCCAATTTATGAAGCTGAAGTCGGATCTGCTGTTAAAGTATTTTCTTCTTCTTCTTCTTCATCGTTTTCCATTTTGTTTTTCATGTTTAGGCTGAATATTTCCTTCACAAGATCGCCAATAAAAGGTGATATCGTTAATTACTCTAGTTTTGACTGTCATTAGTCGCTCATCTTTTTGGCATGACATGAAAGAGAGAGGATTCCGCTCAGCTGCATCAGTTTATACTGCATGCGTCCCTCGACATTGTCCAAGACCTGGCATGGACTACTAGTGCCATGTGAGTTCGTATTCCTTCTAGTTCTTTATTAGATCATCGAGACGCCTTCTTTATCTTTTTTTTTTTTTGTTCTTTTCCCCTTTAAATTTCGGCTTAACTCCCTTGTTGGATTTTATGCAGGTTCTTGAAAGCAGTCGATAGGTTCAATGATTTGGTGGTGTCTGTATATGTAACCGCCGGTCATATCCTTTAA ATGGCGACCACAGCTTGTTTCATCATCGTCAGTAGGAATAATATCCCAATTTATGAAGCTGAAGTCGGATCTGCTGTTAAAAGAGAGGATTCCGCTCAGCTGCATCAGTTTATACTGCATGCGTCCCTCGACATTGTCCAAGACCTGGCATGGACTACTAGTGCCATGTTCTTGAAAGCAGTCGATAGGTTCAATGATTTGGTGGTGTCTGTATATGTAACCGCCGGTCATATCCTTTAA ATGGCGACCACAGCTTGTTTCATCATCGTCAGTAGGAATAATATCCCAATTTATGAAGCTGAAGTCGGATCTGCTGTTAAAAGAGAGGATTCCGCTCAGCTGCATCAGTTTATACTGCATGCGTCCCTCGACATTGTCCAAGACCTGGCATGGACTACTAGTGCCATGTTCTTGAAAGCAGTCGATAGGTTCAATGATTTGGTGGTGTCTGTATATGTAACCGCCGGTCATATCCTTTAA MATTACFIIVSRNNIPIYEAEVGSAVKREDSAQLHQFILHASLDIVQDLAWTTSAMFLKAVDRFNDLVVSVYVTAGHIL*
BLAST of Csa2G338800 vs. Swiss-Prot
Match: TPC2B_HUMAN (Trafficking protein particle complex subunit 2B OS=Homo sapiens GN=TRAPPC2B PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.5e-12 Identity = 34/81 (41.98%), Postives = 52/81 (64.20%), Query Frame = 1
BLAST of Csa2G338800 vs. Swiss-Prot
Match: TPPC2_PONAB (Trafficking protein particle complex subunit 2 OS=Pongo abelii GN=TRAPPC2 PE=2 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.5e-12 Identity = 34/81 (41.98%), Postives = 52/81 (64.20%), Query Frame = 1
BLAST of Csa2G338800 vs. Swiss-Prot
Match: TPPC2_PIG (Trafficking protein particle complex subunit 2 OS=Sus scrofa GN=TRAPPC2 PE=2 SV=2) HSP 1 Score: 72.4 bits (176), Expect = 2.5e-12 Identity = 34/81 (41.98%), Postives = 52/81 (64.20%), Query Frame = 1
BLAST of Csa2G338800 vs. Swiss-Prot
Match: TPPC2_CANLF (Trafficking protein particle complex subunit 2 OS=Canis lupus familiaris GN=TRAPPC2 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.5e-12 Identity = 34/81 (41.98%), Postives = 52/81 (64.20%), Query Frame = 1
BLAST of Csa2G338800 vs. Swiss-Prot
Match: TPPC2_BOVIN (Trafficking protein particle complex subunit 2 OS=Bos taurus GN=TRAPPC2 PE=2 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.5e-12 Identity = 34/81 (41.98%), Postives = 52/81 (64.20%), Query Frame = 1
BLAST of Csa2G338800 vs. TrEMBL
Match: A0A0A0LQF1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G338800 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.1e-35 Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 1
BLAST of Csa2G338800 vs. TrEMBL
Match: A0A067F9D4_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g032720mg PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 3.6e-34 Identity = 75/79 (94.94%), Postives = 78/79 (98.73%), Query Frame = 1
BLAST of Csa2G338800 vs. TrEMBL
Match: A0A067FKI3_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g032720mg PE=4 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 2.4e-33 Identity = 74/79 (93.67%), Postives = 77/79 (97.47%), Query Frame = 1
BLAST of Csa2G338800 vs. TrEMBL
Match: A0A067FL79_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g032720mg PE=4 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 3.1e-33 Identity = 73/77 (94.81%), Postives = 76/77 (98.70%), Query Frame = 1
BLAST of Csa2G338800 vs. TrEMBL
Match: A0A061EJF7_THECC (SNARE-like superfamily protein isoform 1 OS=Theobroma cacao GN=TCM_019945 PE=4 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 6.9e-33 Identity = 72/77 (93.51%), Postives = 76/77 (98.70%), Query Frame = 1
BLAST of Csa2G338800 vs. TAIR10
Match: AT1G80500.1 (AT1G80500.1 SNARE-like superfamily protein) HSP 1 Score: 142.9 bits (359), Expect = 8.6e-35 Identity = 69/77 (89.61%), Postives = 72/77 (93.51%), Query Frame = 1
BLAST of Csa2G338800 vs. NCBI nr
Match: gi|700207117|gb|KGN62236.1| (hypothetical protein Csa_2G338800 [Cucumis sativus]) HSP 1 Score: 156.8 bits (395), Expect = 1.6e-35 Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 1
BLAST of Csa2G338800 vs. NCBI nr
Match: gi|449459192|ref|XP_004147330.1| (PREDICTED: transport protein particle 20 kDa subunit isoform X2 [Cucumis sativus]) HSP 1 Score: 153.7 bits (387), Expect = 1.4e-34 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 1
BLAST of Csa2G338800 vs. NCBI nr
Match: gi|641845079|gb|KDO63968.1| (hypothetical protein CISIN_1g032720mg [Citrus sinensis]) HSP 1 Score: 151.8 bits (382), Expect = 5.2e-34 Identity = 75/79 (94.94%), Postives = 78/79 (98.73%), Query Frame = 1
BLAST of Csa2G338800 vs. NCBI nr
Match: gi|659121801|ref|XP_008460820.1| (PREDICTED: trafficking protein particle complex subunit 2 [Cucumis melo]) HSP 1 Score: 151.8 bits (382), Expect = 5.2e-34 Identity = 76/77 (98.70%), Postives = 76/77 (98.70%), Query Frame = 1
BLAST of Csa2G338800 vs. NCBI nr
Match: gi|778670342|ref|XP_011649448.1| (PREDICTED: transport protein particle 20 kDa subunit isoform X1 [Cucumis sativus]) HSP 1 Score: 150.6 bits (379), Expect = 1.2e-33 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|