Csa1G031870 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.GGGGATTTTGGGTTTAGGGTTATTGTTTGCCAATTGGGCCAAGAAAGAACCCGAATAGGCACCCGAACATAAATCTCATTGTCATCTCAGCGAGCTGAAGCAACCGGAAAGTACTCCAAACGACGATCATTTCCTCCCTTCCGGTGATCATCAAGCAACCGAAAGGTTTCTGGGCAGGCAAGGAACTGACCCCACAGGACACTGAAGACGCGCTACGATGTCCGATCCATATTCAGGGGCGAAAGGAGGTAGGCTCACCTTCAAGGGAGGAGTCTTAGCCTCTCGTAGCAAGGATATTGACAAGAAGAAGAAGAAGAAGAAGAAAGACAAAAGTAAGACCGACGAGAACCCCACGGACGATGGCGAGATTTTGACATCGGCTGATGGTGTAGAAGATGGAGACGGAGCAATGTATACTATTGACGCGGCTAAGCGTATGAAGTACGAGGAGCTATTTCCTGTGGAGACAAGGAAGTTTGGTTACGACCCTAACAACTCCAATACCAAGTTCAAGTCCGTGGAGGATGCTCTCGATGACCGTGTCAAAAAGAAGGCGGATCGTTATTGTAAATAA ATGTCCGATCCATATTCAGGGGCGAAAGGAGGTAGGCTCACCTTCAAGGGAGGAGTCTTAGCCTCTCGTAGCAAGGATATTGACAAGAAGAAGAAGAAGAAGAAGAAAGACAAAAGTAAGACCGACGAGAACCCCACGGACGATGGCGAGATTTTGACATCGGCTGATGGTGTAGAAGATGGAGACGGAGCAATGTATACTATTGACGCGGCTAAGCGTATGAAGTACGAGGAGCTATTTCCTGTGGAGACAAGGAAGTTTGGTTACGACCCTAACAACTCCAATACCAAGTTCAAGTCCGTGGAGGATGCTCTCGATGACCGTGTCAAAAAGAAGGCGGATCGTTATTGTAAATAA ATGTCCGATCCATATTCAGGGGCGAAAGGAGGTAGGCTCACCTTCAAGGGAGGAGTCTTAGCCTCTCGTAGCAAGGATATTGACAAGAAGAAGAAGAAGAAGAAGAAAGACAAAAGTAAGACCGACGAGAACCCCACGGACGATGGCGAGATTTTGACATCGGCTGATGGTGTAGAAGATGGAGACGGAGCAATGTATACTATTGACGCGGCTAAGCGTATGAAGTACGAGGAGCTATTTCCTGTGGAGACAAGGAAGTTTGGTTACGACCCTAACAACTCCAATACCAAGTTCAAGTCCGTGGAGGATGCTCTCGATGACCGTGTCAAAAAGAAGGCGGATCGTTATTGTAAATAA MSDPYSGAKGGRLTFKGGVLASRSKDIDKKKKKKKKDKSKTDENPTDDGEILTSADGVEDGDGAMYTIDAAKRMKYEELFPVETRKFGYDPNNSNTKFKSVEDALDDRVKKKADRYCK*
BLAST of Csa1G031870 vs. TrEMBL
Match: A0A0A0LVD6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G031870 PE=4 SV=1) HSP 1 Score: 242.3 bits (617), Expect = 3.1e-61 Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1
BLAST of Csa1G031870 vs. TrEMBL
Match: A0A068TTB9_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00022748001 PE=4 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 6.4e-35 Identity = 82/120 (68.33%), Postives = 92/120 (76.67%), Query Frame = 1
BLAST of Csa1G031870 vs. TrEMBL
Match: C6T1K8_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 5.4e-34 Identity = 82/132 (62.12%), Postives = 93/132 (70.45%), Query Frame = 1
BLAST of Csa1G031870 vs. TrEMBL
Match: A0A0R0IPL9_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_08G057500 PE=4 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.6e-33 Identity = 81/132 (61.36%), Postives = 92/132 (69.70%), Query Frame = 1
BLAST of Csa1G031870 vs. TrEMBL
Match: A0A0B2NSL5_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_028649 PE=4 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 1.6e-33 Identity = 81/132 (61.36%), Postives = 92/132 (69.70%), Query Frame = 1
BLAST of Csa1G031870 vs. TAIR10
Match: AT2G25720.1 (AT2G25720.1 unknown protein) HSP 1 Score: 122.9 bits (307), Expect = 1.4e-28 Identity = 70/123 (56.91%), Postives = 80/123 (65.04%), Query Frame = 1
BLAST of Csa1G031870 vs. NCBI nr
Match: gi|778656758|ref|XP_004137395.2| (PREDICTED: uncharacterized protein LOC101213981 [Cucumis sativus]) HSP 1 Score: 242.3 bits (617), Expect = 4.4e-61 Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 1
BLAST of Csa1G031870 vs. NCBI nr
Match: gi|659066319|ref|XP_008438568.1| (PREDICTED: uncharacterized protein LOC103483601 [Cucumis melo]) HSP 1 Score: 234.2 bits (596), Expect = 1.2e-58 Identity = 114/118 (96.61%), Postives = 116/118 (98.31%), Query Frame = 1
BLAST of Csa1G031870 vs. NCBI nr
Match: gi|661898626|emb|CDO98593.1| (unnamed protein product [Coffea canephora]) HSP 1 Score: 154.8 bits (390), Expect = 9.2e-35 Identity = 82/120 (68.33%), Postives = 92/120 (76.67%), Query Frame = 1
BLAST of Csa1G031870 vs. NCBI nr
Match: gi|697111063|ref|XP_009609411.1| (PREDICTED: uncharacterized protein LOC104103225 [Nicotiana tomentosiformis]) HSP 1 Score: 152.5 bits (384), Expect = 4.6e-34 Identity = 80/122 (65.57%), Postives = 89/122 (72.95%), Query Frame = 1
BLAST of Csa1G031870 vs. NCBI nr
Match: gi|351723329|ref|NP_001237275.1| (uncharacterized protein LOC100500388 [Glycine max]) HSP 1 Score: 151.8 bits (382), Expect = 7.8e-34 Identity = 82/132 (62.12%), Postives = 93/132 (70.45%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|