Csa1G000670 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAAGAATTTGGGTAAGGAAATCGGGCATGTAGATAGGATTTGATAAAAATGGATAATATGGAGGGAGAAGCAATGTCCACCACTCATCAAAACCAGTAAAACTACTTAATCCAATCCCTTCTTCATCTTCCTATCCTCCATGTTTCTGGGGTTTTGAAGTTTATTATACAAACGTAACTACACCCTCATTATTCAGTGGTAATGGCTTCTTTTTCAGCTACTTCCCTCAGATTCTGCATGCCTATCAACCAAGCTAACAAAATGAACCACAATCAGGTGTTCTTTCTATCCTATCTATCTATTGTATATACAATTCTGTAGCCTAAAATGGTTCTTTATATATCATTAATTAACTGTATGCTGCTGCTTGCAGCTTCTCAGAAGAAGCTTGCTCGGCCGGGGATTTCTCAACAATAATAATGCTTTCCACTTTCGTGTCTCTTGTGCGGTAATTTAACTCGAAGTGTCTCTAAACTAATTTGTGAATTTGAGTTTCAAACTAATTAAGTGTATGAACAGGCAAAACCAGAGACACTTGACAAAGTGTGTTCAATTGTGAGGAAACAATTGGCCTTGCCTGAAACCTCAGAGCTCACCCCCGAATCTAAGTTCGCGGCTCTTGGTGCTGATTCCCTCGACACAGTACGTCCTCTTATCCTTACTTAATTTAACTACCATTCTGTTCATTGCTTGAATATATATATGTGTGTGTGTGTCGGAATGGCCACACAGGTGGAGATTATTATGACCTTAGAGGAAGAATTTAGCATCAATATCGAAGAGGATAACGCTCAGAACATAACCACAGTGCAAGAAGCTGCCGATTTGATTGAGAACCTTGTTGTTAAACAGCAATCTTAAAAGACTATATATAGCTTTGCTTTTAGTATTATGTTGAAGTTGTATTATTCCAAGAGGCAGATGACAAGAGTTTGGTTGGGGTTGGGTTGAGCAAATAGGATTAGAATGTTCTTTTTTTCCTCAAATGATTTTTTTAAGCAAATTAATGTACTTCTACTCCATCAACGTAACTTGTTAGCTACAAAATTTAAAATGTAATATGAATTGTAGTGTTGTGTTGTTTTCTGTTCTCTAAACGAGGAGAGGATCGATCAGTCTATTTCAGTGATTCCAGTGGAGAC ATGGCTTCTTTTTCAGCTACTTCCCTCAGATTCTGCATGCCTATCAACCAAGCTAACAAAATGAACCACAATCAGCTTCTCAGAAGAAGCTTGCTCGGCCGGGGATTTCTCAACAATAATAATGCTTTCCACTTTCGTGTCTCTTGTGCGGCAAAACCAGAGACACTTGACAAAGTGTGTTCAATTGTGAGGAAACAATTGGCCTTGCCTGAAACCTCAGAGCTCACCCCCGAATCTAAGTTCGCGGCTCTTGGTGCTGATTCCCTCGACACAGTGGAGATTATTATGACCTTAGAGGAAGAATTTAGCATCAATATCGAAGAGGATAACGCTCAGAACATAACCACAGTGCAAGAAGCTGCCGATTTGATTGAGAACCTTGTTGTTAAACAGCAATCTTAA ATGGCTTCTTTTTCAGCTACTTCCCTCAGATTCTGCATGCCTATCAACCAAGCTAACAAAATGAACCACAATCAGCTTCTCAGAAGAAGCTTGCTCGGCCGGGGATTTCTCAACAATAATAATGCTTTCCACTTTCGTGTCTCTTGTGCGGCAAAACCAGAGACACTTGACAAAGTGTGTTCAATTGTGAGGAAACAATTGGCCTTGCCTGAAACCTCAGAGCTCACCCCCGAATCTAAGTTCGCGGCTCTTGGTGCTGATTCCCTCGACACAGTGGAGATTATTATGACCTTAGAGGAAGAATTTAGCATCAATATCGAAGAGGATAACGCTCAGAACATAACCACAGTGCAAGAAGCTGCCGATTTGATTGAGAACCTTGTTGTTAAACAGCAATCTTAA MASFSATSLRFCMPINQANKMNHNQLLRRSLLGRGFLNNNNAFHFRVSCAAKPETLDKVCSIVRKQLALPETSELTPESKFAALGADSLDTVEIIMTLEEEFSINIEEDNAQNITTVQEAADLIENLVVKQQS*
BLAST of Csa1G000670 vs. Swiss-Prot
Match: ACP4_ARATH (Acyl carrier protein 4, chloroplastic OS=Arabidopsis thaliana GN=ACP4 PE=2 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 8.5e-29 Identity = 69/131 (52.67%), Postives = 90/131 (68.70%), Query Frame = 1
BLAST of Csa1G000670 vs. Swiss-Prot
Match: ACP1_CASGL (Acyl carrier protein 1, chloroplastic OS=Casuarina glauca GN=ACP1 PE=2 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.2e-28 Identity = 62/87 (71.26%), Postives = 74/87 (85.06%), Query Frame = 1
BLAST of Csa1G000670 vs. Swiss-Prot
Match: ACP2_CUPLA (Acyl carrier protein 2, chloroplastic OS=Cuphea lanceolata GN=ACL1.2 PE=2 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 9.4e-28 Identity = 60/98 (61.22%), Postives = 79/98 (80.61%), Query Frame = 1
BLAST of Csa1G000670 vs. Swiss-Prot
Match: ACP1_CUPLA (Acyl carrier protein 1, chloroplastic OS=Cuphea lanceolata GN=ACL1.1 PE=2 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 3.6e-27 Identity = 61/94 (64.89%), Postives = 77/94 (81.91%), Query Frame = 1
BLAST of Csa1G000670 vs. Swiss-Prot
Match: ACP4_CUPLA (Acyl carrier protein 4, chloroplastic OS=Cuphea lanceolata GN=ACL1 PE=3 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 3.0e-26 Identity = 61/95 (64.21%), Postives = 75/95 (78.95%), Query Frame = 1
BLAST of Csa1G000670 vs. TrEMBL
Match: A0A0A0LNR6_CUCSA (Acyl carrier protein OS=Cucumis sativus GN=Csa_1G000670 PE=3 SV=1) HSP 1 Score: 260.4 bits (664), Expect = 1.2e-66 Identity = 133/133 (100.00%), Postives = 133/133 (100.00%), Query Frame = 1
BLAST of Csa1G000670 vs. TrEMBL
Match: E5GBM2_CUCME (Acyl carrier protein OS=Cucumis melo subsp. melo PE=3 SV=1) HSP 1 Score: 243.4 bits (620), Expect = 1.5e-61 Identity = 124/133 (93.23%), Postives = 129/133 (96.99%), Query Frame = 1
BLAST of Csa1G000670 vs. TrEMBL
Match: A0A059BF77_EUCGR (Acyl carrier protein OS=Eucalyptus grandis GN=EUGRSUZ_G01960 PE=3 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 1.2e-32 Identity = 83/134 (61.94%), Postives = 100/134 (74.63%), Query Frame = 1
BLAST of Csa1G000670 vs. TrEMBL
Match: A0A059BDY2_EUCGR (Acyl carrier protein OS=Eucalyptus grandis GN=EUGRSUZ_G01960 PE=3 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 2.8e-31 Identity = 83/135 (61.48%), Postives = 100/135 (74.07%), Query Frame = 1
BLAST of Csa1G000670 vs. TrEMBL
Match: B9I3Y4_POPTR (Acyl carrier protein OS=Populus trichocarpa GN=POPTR_0012s10710g PE=3 SV=2) HSP 1 Score: 140.6 bits (353), Expect = 1.4e-30 Identity = 80/133 (60.15%), Postives = 97/133 (72.93%), Query Frame = 1
BLAST of Csa1G000670 vs. TAIR10
Match: AT4G25050.2 (AT4G25050.2 acyl carrier protein 4) HSP 1 Score: 119.0 bits (297), Expect = 2.2e-27 Identity = 69/143 (48.25%), Postives = 90/143 (62.94%), Query Frame = 1
BLAST of Csa1G000670 vs. TAIR10
Match: AT1G54580.1 (AT1G54580.1 acyl carrier protein 2) HSP 1 Score: 114.0 bits (284), Expect = 7.1e-26 Identity = 56/85 (65.88%), Postives = 69/85 (81.18%), Query Frame = 1
BLAST of Csa1G000670 vs. TAIR10
Match: AT1G54630.1 (AT1G54630.1 acyl carrier protein 3) HSP 1 Score: 112.5 bits (280), Expect = 2.1e-25 Identity = 55/85 (64.71%), Postives = 69/85 (81.18%), Query Frame = 1
BLAST of Csa1G000670 vs. TAIR10
Match: AT5G27200.1 (AT5G27200.1 acyl carrier protein 5) HSP 1 Score: 105.9 bits (263), Expect = 1.9e-23 Identity = 63/127 (49.61%), Postives = 80/127 (62.99%), Query Frame = 1
BLAST of Csa1G000670 vs. TAIR10
Match: AT3G05020.1 (AT3G05020.1 acyl carrier protein 1) HSP 1 Score: 103.6 bits (257), Expect = 9.7e-23 Identity = 61/126 (48.41%), Postives = 80/126 (63.49%), Query Frame = 1
BLAST of Csa1G000670 vs. NCBI nr
Match: gi|449440504|ref|XP_004138024.1| (PREDICTED: acyl carrier protein 4, chloroplastic [Cucumis sativus]) HSP 1 Score: 260.4 bits (664), Expect = 1.7e-66 Identity = 133/133 (100.00%), Postives = 133/133 (100.00%), Query Frame = 1
BLAST of Csa1G000670 vs. NCBI nr
Match: gi|659128820|ref|XP_008464386.1| (PREDICTED: acyl carrier protein 4, chloroplastic [Cucumis melo]) HSP 1 Score: 243.4 bits (620), Expect = 2.2e-61 Identity = 124/133 (93.23%), Postives = 129/133 (96.99%), Query Frame = 1
BLAST of Csa1G000670 vs. NCBI nr
Match: gi|702418586|ref|XP_010066441.1| (PREDICTED: acyl carrier protein 4, chloroplastic isoform X2 [Eucalyptus grandis]) HSP 1 Score: 147.5 bits (371), Expect = 1.7e-32 Identity = 83/134 (61.94%), Postives = 100/134 (74.63%), Query Frame = 1
BLAST of Csa1G000670 vs. NCBI nr
Match: gi|702418546|ref|XP_010066440.1| (PREDICTED: acyl carrier protein 4, chloroplastic isoform X1 [Eucalyptus grandis]) HSP 1 Score: 142.9 bits (359), Expect = 4.1e-31 Identity = 83/135 (61.48%), Postives = 100/135 (74.07%), Query Frame = 1
BLAST of Csa1G000670 vs. NCBI nr
Match: gi|747086702|ref|XP_011090862.1| (PREDICTED: acyl carrier protein 1, chloroplastic-like [Sesamum indicum]) HSP 1 Score: 141.0 bits (354), Expect = 1.5e-30 Identity = 80/135 (59.26%), Postives = 103/135 (76.30%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|