Cp4.1LG16g08510 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATGATATCTTCGGCAAGTACGGGGCGATCCGGCAGATTCGGATTGGGACGAACAAGGATACGAGAGGTACCGCCTTTGTTGTTTACGAAGATATCTATGATGCTAAGACGGCGGTGGATCACCTCTCCGGTTTCAACGTTGCGAATCGGTATCTGATCGTGTTGTACTACCAGCAGGCCAAGATGAGCAAAAAGTTCGACCAGAAGAAGAAAGAGGATGAAATCGCCAGGATGCAAGAGAAGTACGGTGTTTCCACGAAAGATAAGTAA ATGTATGATATCTTCGGCAAGTACGGGGCGATCCGGCAGATTCGGATTGGGACGAACAAGGATACGAGAGGTACCGCCTTTGTTGTTTACGAAGATATCTATGATGCTAAGACGGCGGTGGATCACCTCTCCGGTTTCAACGTTGCGAATCGGTATCTGATCGTGTTGTACTACCAGCAGGCCAAGATGAGCAAAAAGTTCGACCAGAAGAAGAAAGAGGATGAAATCGCCAGGATGCAAGAGAAGTACGGTGTTTCCACGAAAGATAAGTAA ATGTATGATATCTTCGGCAAGTACGGGGCGATCCGGCAGATTCGGATTGGGACGAACAAGGATACGAGAGGTACCGCCTTTGTTGTTTACGAAGATATCTATGATGCTAAGACGGCGGTGGATCACCTCTCCGGTTTCAACGTTGCGAATCGGTATCTGATCGTGTTGTACTACCAGCAGGCCAAGATGAGCAAAAAGTTCGACCAGAAGAAGAAAGAGGATGAAATCGCCAGGATGCAAGAGAAGTACGGTGTTTCCACGAAAGATAAGTAA MYDIFGKYGAIRQIRIGTNKDTRGTAFVVYEDIYDAKTAVDHLSGFNVANRYLIVLYYQQAKMSKKFDQKKKEDEIARMQEKYGVSTKDK
BLAST of Cp4.1LG16g08510 vs. Swiss-Prot
Match: SF3B6_ARATH (Splicing factor 3B subunit 6-like protein OS=Arabidopsis thaliana GN=At5g12190 PE=2 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 2.1e-39 Identity = 80/90 (88.89%), Postives = 84/90 (93.33%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. Swiss-Prot
Match: SF3B6_MOUSE (Splicing factor 3B subunit 6 OS=Mus musculus GN=Sf3b6 PE=1 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.2e-28 Identity = 57/87 (65.52%), Postives = 71/87 (81.61%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. Swiss-Prot
Match: SF3B6_HUMAN (Splicing factor 3B subunit 6 OS=Homo sapiens GN=SF3B6 PE=1 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.2e-28 Identity = 57/87 (65.52%), Postives = 71/87 (81.61%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. Swiss-Prot
Match: SF3B6_DROME (Splicing factor 3B subunit 6-like protein OS=Drosophila melanogaster GN=CG13298 PE=1 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 1.8e-27 Identity = 57/89 (64.04%), Postives = 70/89 (78.65%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. Swiss-Prot
Match: SF3B6_CAEEL (Splicing factor 3B subunit 6-like protein OS=Caenorhabditis elegans GN=C50D2.5 PE=3 SV=2) HSP 1 Score: 117.9 bits (294), Expect = 5.9e-26 Identity = 52/85 (61.18%), Postives = 70/85 (82.35%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. TrEMBL
Match: A0A0B2S153_GLYSO (Pre-mRNA branch site p14-like protein OS=Glycine soja GN=glysoja_004058 PE=4 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 8.2e-43 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. TrEMBL
Match: A0A0L9UUV9_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan07g035900 PE=4 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 8.2e-43 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. TrEMBL
Match: I1JIW3_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_02G278800 PE=4 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 8.2e-43 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. TrEMBL
Match: B7FGI3_MEDTR (Pre-mRNA branch site p14-like protein OS=Medicago truncatula GN=MTR_5g089300 PE=2 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 8.2e-43 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. TrEMBL
Match: V7B6G4_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_008G202000g PE=4 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 8.2e-43 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. TAIR10
Match: AT5G12190.1 (AT5G12190.1 RNA-binding (RRM/RBD/RNP motifs) family protein) HSP 1 Score: 162.5 bits (410), Expect = 1.2e-40 Identity = 80/90 (88.89%), Postives = 84/90 (93.33%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. TAIR10
Match: AT2G14870.1 (AT2G14870.1 RNA-binding (RRM/RBD/RNP motifs) family protein) HSP 1 Score: 73.6 bits (179), Expect = 7.2e-14 Identity = 32/42 (76.19%), Postives = 36/42 (85.71%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. NCBI nr
Match: gi|922357372|ref|XP_003617230.2| (Pre-mRNA branch site p14-like protein [Medicago truncatula]) HSP 1 Score: 180.6 bits (457), Expect = 1.2e-42 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. NCBI nr
Match: gi|356501392|ref|XP_003519509.1| (PREDICTED: splicing factor 3B subunit 6-like protein [Glycine max]) HSP 1 Score: 180.6 bits (457), Expect = 1.2e-42 Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. NCBI nr
Match: gi|356554173|ref|XP_003545423.1| (PREDICTED: splicing factor 3B subunit 6-like protein [Glycine max]) HSP 1 Score: 180.3 bits (456), Expect = 1.5e-42 Identity = 89/90 (98.89%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. NCBI nr
Match: gi|659097475|ref|XP_008449647.1| (PREDICTED: splicing factor 3B subunit 6-like protein [Cucumis melo]) HSP 1 Score: 179.9 bits (455), Expect = 2.0e-42 Identity = 89/90 (98.89%), Postives = 90/90 (100.00%), Query Frame = 1
BLAST of Cp4.1LG16g08510 vs. NCBI nr
Match: gi|802558799|ref|XP_012065832.1| (PREDICTED: splicing factor 3B subunit 6-like protein [Jatropha curcas]) HSP 1 Score: 179.1 bits (453), Expect = 3.4e-42 Identity = 89/90 (98.89%), Postives = 90/90 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|