Cp4.1LG15g07280 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTATAAGAAAGTTATGAATGAGGCAGATGATGAGAAGTATAAGCTTTGTTTAAGGAGGACGAGGAGGAATAGGACTAAACATCTTTGCCATGTTCGGGGAAATATGCACAAGAAAGTTAGGATTGCAGCTCAGGGTATCATATTCAGTGGACTTCAGGACTATCAAGACGACAAAGCTGATATGATTCTCAAATACATGCCTGATGAAGCCAGGCTTTCGAAAGCTTTATCGTGA ATGTATAAGAAAGTTATGAATGAGGCAGATGATGAGAAGTATAAGCTTTGTTTAAGGAGGACGAGGAGGAATAGGACTAAACATCTTTGCCATGTTCGGGGAAATATGCACAAGAAAGTTAGGATTGCAGCTCAGGGTATCATATTCAGTGGACTTCAGGACTATCAAGACGACAAAGCTGATATGATTCTCAAATACATGCCTGATGAAGCCAGGCTTTCGAAAGCTTTATCGTGA ATGTATAAGAAAGTTATGAATGAGGCAGATGATGAGAAGTATAAGCTTTGTTTAAGGAGGACGAGGAGGAATAGGACTAAACATCTTTGCCATGTTCGGGGAAATATGCACAAGAAAGTTAGGATTGCAGCTCAGGGTATCATATTCAGTGGACTTCAGGACTATCAAGACGACAAAGCTGATATGATTCTCAAATACATGCCTGATGAAGCCAGGCTTTCGAAAGCTTTATCGTGA MYKKVMNEADDEKYKLCLRRTRRNRTKHLCHVRGNMHKKVRIAAQGIIFSGLQDYQDDKADMILKYMPDEARLSKALS
BLAST of Cp4.1LG15g07280 vs. Swiss-Prot
Match: IF1A_ONOVI (Eukaryotic translation initiation factor 1A OS=Onobrychis viciifolia PE=2 SV=2) HSP 1 Score: 81.3 bits (199), Expect = 5.3e-15 Identity = 50/93 (53.76%), Postives = 55/93 (59.14%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. Swiss-Prot
Match: IF1A_WHEAT (Eukaryotic translation initiation factor 1A OS=Triticum aestivum PE=1 SV=2) HSP 1 Score: 80.1 bits (196), Expect = 1.2e-14 Identity = 46/93 (49.46%), Postives = 56/93 (60.22%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. Swiss-Prot
Match: IF1AX_HUMAN (Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens GN=EIF1AX PE=1 SV=2) HSP 1 Score: 63.9 bits (154), Expect = 8.8e-10 Identity = 31/50 (62.00%), Postives = 36/50 (72.00%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. Swiss-Prot
Match: IF1AX_MOUSE (Eukaryotic translation initiation factor 1A, X-chromosomal OS=Mus musculus GN=Eif1ax PE=2 SV=3) HSP 1 Score: 63.9 bits (154), Expect = 8.8e-10 Identity = 31/50 (62.00%), Postives = 36/50 (72.00%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. Swiss-Prot
Match: IF1AX_PONAB (Eukaryotic translation initiation factor 1A, X-chromosomal OS=Pongo abelii GN=EIF1AX PE=2 SV=3) HSP 1 Score: 63.9 bits (154), Expect = 8.8e-10 Identity = 31/50 (62.00%), Postives = 36/50 (72.00%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. TrEMBL
Match: A0A0D2MUE8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G061900 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.1e-14 Identity = 51/93 (54.84%), Postives = 58/93 (62.37%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. TrEMBL
Match: G7ZYQ6_MEDTR (Eukaryotic translation initiation factor 1A OS=Medicago truncatula GN=MTR_8g028180 PE=3 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.4e-14 Identity = 53/95 (55.79%), Postives = 57/95 (60.00%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. TrEMBL
Match: I3SEC1_MEDTR (Uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 86.7 bits (213), Expect = 1.4e-14 Identity = 53/95 (55.79%), Postives = 57/95 (60.00%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. TrEMBL
Match: B5M1Y2_RHEAU (Translation initiation factor OS=Rheum australe PE=2 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.8e-14 Identity = 50/93 (53.76%), Postives = 57/93 (61.29%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. TrEMBL
Match: A0A140GXY4_9FABA (Eukaryotic translation initiation factor 1A (Fragment) OS=Aeschynomene pfundii GN=eIF-1A PE=3 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 3.1e-14 Identity = 52/93 (55.91%), Postives = 56/93 (60.22%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. TAIR10
Match: AT2G04520.1 (AT2G04520.1 Nucleic acid-binding, OB-fold-like protein) HSP 1 Score: 82.0 bits (201), Expect = 1.8e-16 Identity = 50/93 (53.76%), Postives = 55/93 (59.14%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. TAIR10
Match: AT5G35680.3 (AT5G35680.3 Nucleic acid-binding, OB-fold-like protein) HSP 1 Score: 80.5 bits (197), Expect = 5.1e-16 Identity = 50/93 (53.76%), Postives = 54/93 (58.06%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. NCBI nr
Match: gi|823147456|ref|XP_012473639.1| (PREDICTED: eukaryotic translation initiation factor 1A-like [Gossypium raimondii]) HSP 1 Score: 87.0 bits (214), Expect = 1.5e-14 Identity = 51/93 (54.84%), Postives = 58/93 (62.37%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. NCBI nr
Match: gi|388501094|gb|AFK38613.1| (unknown [Medicago truncatula]) HSP 1 Score: 86.7 bits (213), Expect = 2.0e-14 Identity = 53/95 (55.79%), Postives = 57/95 (60.00%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. NCBI nr
Match: gi|922333446|ref|XP_013444714.1| (eukaryotic translation initiation factor 1A-like protein [Medicago truncatula]) HSP 1 Score: 86.7 bits (213), Expect = 2.0e-14 Identity = 53/95 (55.79%), Postives = 57/95 (60.00%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. NCBI nr
Match: gi|197312901|gb|ACH63231.1| (translation initiation factor [Rheum australe]) HSP 1 Score: 86.3 bits (212), Expect = 2.6e-14 Identity = 50/93 (53.76%), Postives = 57/93 (61.29%), Query Frame = 1
BLAST of Cp4.1LG15g07280 vs. NCBI nr
Match: gi|225454422|ref|XP_002279938.1| (PREDICTED: eukaryotic translation initiation factor 1A [Vitis vinifera]) HSP 1 Score: 85.5 bits (210), Expect = 4.5e-14 Identity = 52/93 (55.91%), Postives = 56/93 (60.22%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|