Cp4.1LG08g03580 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTCATGTCCAGGTAATAGACTCACAACTCATGATCCTCGCTTCTCTTTGTCTCTGTGTCTGTGTGTGTGTCTTAGGAGATGTGTTTTGGCGACCAGGTAAGAGCTCATGGCCGCATCTGGTGGGGGTGGGCGGCTCAGCCGCCAAGGCCATTATCGAGAGGGAGAATCCGAACGTGAAAGCCGTCATTTTGGAGGTGGGAACCCCCGTCACCAAGGACTTCCGCTGTAATCGGGTTCGGATTTGGGTCAATAAGCGTGGACTTGTTGCAAGCCCACCTCGAATAGGCTGA ATGTCTTCATGTCCAGGTAAGAGCTCATGGCCGCATCTGGTGGGGGTGGGCGGCTCAGCCGCCAAGGCCATTATCGAGAGGGAGAATCCGAACGTGAAAGCCGTCATTTTGGAGGTGGGAACCCCCGTCACCAAGGACTTCCGCTGTAATCGGGTTCGGATTTGGGTCAATAAGCGTGGACTTGTTGCAAGCCCACCTCGAATAGGCTGA ATGTCTTCATGTCCAGGTAAGAGCTCATGGCCGCATCTGGTGGGGGTGGGCGGCTCAGCCGCCAAGGCCATTATCGAGAGGGAGAATCCGAACGTGAAAGCCGTCATTTTGGAGGTGGGAACCCCCGTCACCAAGGACTTCCGCTGTAATCGGGTTCGGATTTGGGTCAATAAGCGTGGACTTGTTGCAAGCCCACCTCGAATAGGCTGA MSSCPGKSSWPHLVGVGGSAAKAIIERENPNVKAVILEVGTPVTKDFRCNRVRIWVNKRGLVASPPRIG
BLAST of Cp4.1LG08g03580 vs. Swiss-Prot
Match: ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 4.2e-32 Identity = 64/68 (94.12%), Postives = 65/68 (95.59%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. Swiss-Prot
Match: BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 1.4e-22 Identity = 47/68 (69.12%), Postives = 56/68 (82.35%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. Swiss-Prot
Match: ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum PE=1 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 2.7e-15 Identity = 36/65 (55.38%), Postives = 48/65 (73.85%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. Swiss-Prot
Match: HPI_HEVBR (Protease inhibitor HPI OS=Hevea brasiliensis GN=PI1 PE=1 SV=2) HSP 1 Score: 76.3 bits (186), Expect = 1.5e-13 Identity = 33/68 (48.53%), Postives = 46/68 (67.65%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. Swiss-Prot
Match: ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus PE=1 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.0e-13 Identity = 34/65 (52.31%), Postives = 44/65 (67.69%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. TrEMBL
Match: Q7M1Q1_MOMCH (Trypsin inhibitor BGIT OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.0e-20 Identity = 47/68 (69.12%), Postives = 57/68 (83.82%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. TrEMBL
Match: Q9AYN0_MOMCH (Inhibitor against trypsin (Fragment) OS=Momordica charantia GN=bgit PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.4e-20 Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. TrEMBL
Match: M0SNM6_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 9.2e-18 Identity = 46/69 (66.67%), Postives = 51/69 (73.91%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. TrEMBL
Match: A0A0D2QSL7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_007G143500 PE=4 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.2e-17 Identity = 43/69 (62.32%), Postives = 51/69 (73.91%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. TrEMBL
Match: I7GGD4_GOSAR (Inhibitor of trypsin and hageman factor OS=Gossypium arboreum GN=F383_22107 PE=2 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.6e-17 Identity = 43/69 (62.32%), Postives = 50/69 (72.46%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 78.2 bits (191), Expect = 2.2e-15 Identity = 33/68 (48.53%), Postives = 45/68 (66.18%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. TAIR10
Match: AT5G43580.1 (AT5G43580.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 78.2 bits (191), Expect = 2.2e-15 Identity = 37/65 (56.92%), Postives = 45/65 (69.23%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. TAIR10
Match: AT3G46860.1 (AT3G46860.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 66.2 bits (160), Expect = 8.8e-12 Identity = 31/63 (49.21%), Postives = 38/63 (60.32%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. TAIR10
Match: AT2G38900.2 (AT2G38900.2 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 61.6 bits (148), Expect = 2.2e-10 Identity = 26/64 (40.62%), Postives = 40/64 (62.50%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. TAIR10
Match: AT5G43570.1 (AT5G43570.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 52.4 bits (124), Expect = 1.3e-07 Identity = 27/60 (45.00%), Postives = 33/60 (55.00%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. NCBI nr
Match: gi|253723128|pdb|1TIN|A (Chain A, Three-Dimensional Structure In Solution Of Cucurbita Maxima Trypsin Inhibitor-V Determined By Nmr Spectroscopy) HSP 1 Score: 137.9 bits (346), Expect = 6.7e-30 Identity = 64/68 (94.12%), Postives = 65/68 (95.59%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. NCBI nr
Match: gi|124984|sp|P19873.1|ITH5_CUCMA (RecName: Full=Inhibitor of trypsin and hageman factor; AltName: Full=CMTI-V) HSP 1 Score: 137.9 bits (346), Expect = 6.7e-30 Identity = 64/68 (94.12%), Postives = 65/68 (95.59%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. NCBI nr
Match: gi|159162696|pdb|1MIT|A (Chain A, Recombinant Cucurbita Maxima Trypsin Inhibitor V (Rcmti-V) (Nmr, Minimized Average Structure)) HSP 1 Score: 137.9 bits (346), Expect = 6.7e-30 Identity = 64/68 (94.12%), Postives = 65/68 (95.59%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. NCBI nr
Match: gi|659077749|ref|XP_008439364.1| (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 120.6 bits (301), Expect = 1.1e-24 Identity = 55/63 (87.30%), Postives = 58/63 (92.06%), Query Frame = 1
BLAST of Cp4.1LG08g03580 vs. NCBI nr
Match: gi|114950|sp|P24076.1|BGIA_MOMCH (RecName: Full=Glu S.griseus protease inhibitor; AltName: Full=BGIA) HSP 1 Score: 106.3 bits (264), Expect = 2.2e-20 Identity = 47/68 (69.12%), Postives = 56/68 (82.35%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |