ClCG05G004550 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ACTCCACTACGGTTCATTTCACATTTTTCAGTGAGGAAGGTTTCCCCAAAGGTAGCTCTGCCAATAATTAAGGATGTCTCTGTGTGATGGTAACTATCTAGATTTTTTCTCCAAAATAATAATGTGATATTTTCTTCTTTGCATCTAATATTTGTAAATGTAATTTGCATCGTCTTATCCGTTTTGTTTTGTTTAAGGTAAAAAATCGTGGCCGGAGCTGGTCGGAAAACATGGAAAGGCGGCGGAGGAGACGATTGAGAGAGAGGTTCCTTGGGTAAATGCTAAGGTTGTTCAAGAAGGAACCACTTTTGTCACTGCTGATTATAGATGTGATAGAGTTTGGGTTTGGGTTAATAAGCATGGCTTTGTTACTAGAATTCCCATTATTGGTTAATTACCCCTTCAATATTATAATCAAACTCTCTCTCTCTTCTTAATTACTAATTACTCCATTACTCTAAAATTAATGTACTCATTGCTTCAAATGAAATTTAAGCCTCCCAACTTTCTCTTGGA ACTCCACTACGGTTCATTTCACATTTTTCAGTGAGGAAGGTTTCCCCAAAGGTAGCTCTGCCAATAATTAAGGATGTCTCTGTGTGATGGTAAAAAATCGTGGCCGGAGCTGGTCGGAAAACATGGAAAGGCGGCGGAGGAGACGATTGAGAGAGAGGTTCCTTGGGTAAATGCTAAGGTTGTTCAAGAAGGAACCACTTTTGTCACTGCTGATTATAGATGTGATAGAGTTTGGGTTTGGGTTAATAAGCATGGCTTTGTTACTAGAATTCCCATTATTGGTTAATTACCCCTTCAATATTATAATCAAACTCTCTCTCTCTTCTTAATTACTAATTACTCCATTACTCTAAAATTAATGTACTCATTGCTTCAAATGAAATTTAAGCCTCCCAACTTTCTCTTGGA ATGTCTCTGTGTGATGGTAAAAAATCGTGGCCGGAGCTGGTCGGAAAACATGGAAAGGCGGCGGAGGAGACGATTGAGAGAGAGGTTCCTTGGGTAAATGCTAAGGTTGTTCAAGAAGGAACCACTTTTGTCACTGCTGATTATAGATGTGATAGAGTTTGGGTTTGGGTTAATAAGCATGGCTTTGTTACTAGAATTCCCATTATTGGTTAA MSLCDGKKSWPELVGKHGKAAEETIEREVPWVNAKVVQEGTTFVTADYRCDRVWVWVNKHGFVTRIPIIG
BLAST of ClCG05G004550 vs. Swiss-Prot
Match: BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.4e-14 Identity = 40/69 (57.97%), Postives = 47/69 (68.12%), Query Frame = 1
BLAST of ClCG05G004550 vs. Swiss-Prot
Match: ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum PE=1 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 5.3e-14 Identity = 38/66 (57.58%), Postives = 45/66 (68.18%), Query Frame = 1
BLAST of ClCG05G004550 vs. Swiss-Prot
Match: ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 7.6e-13 Identity = 37/69 (53.62%), Postives = 43/69 (62.32%), Query Frame = 1
BLAST of ClCG05G004550 vs. Swiss-Prot
Match: ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus PE=1 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.6e-10 Identity = 34/64 (53.12%), Postives = 39/64 (60.94%), Query Frame = 1
BLAST of ClCG05G004550 vs. Swiss-Prot
Match: ICI1_SOLLC (Wound-induced proteinase inhibitor 1 OS=Solanum lycopersicum GN=PIIF PE=2 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.1e-08 Identity = 29/68 (42.65%), Postives = 44/68 (64.71%), Query Frame = 1
BLAST of ClCG05G004550 vs. TrEMBL
Match: M5Y1Z6_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa025505mg PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.0e-17 Identity = 47/69 (68.12%), Postives = 53/69 (76.81%), Query Frame = 1
BLAST of ClCG05G004550 vs. TrEMBL
Match: I1NI60_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_20G205900 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.0e-17 Identity = 46/70 (65.71%), Postives = 54/70 (77.14%), Query Frame = 1
BLAST of ClCG05G004550 vs. TrEMBL
Match: A0A0B2PVG1_GLYSO (Glu S.griseus protease inhibitor OS=Glycine soja GN=glysoja_040425 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.0e-17 Identity = 46/70 (65.71%), Postives = 54/70 (77.14%), Query Frame = 1
BLAST of ClCG05G004550 vs. TrEMBL
Match: A0A0L9TZF4_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan02g169400 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.0e-17 Identity = 44/70 (62.86%), Postives = 54/70 (77.14%), Query Frame = 1
BLAST of ClCG05G004550 vs. TrEMBL
Match: A0A0S3SPN2_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.08G139400 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.0e-17 Identity = 44/70 (62.86%), Postives = 54/70 (77.14%), Query Frame = 1
BLAST of ClCG05G004550 vs. TAIR10
Match: AT5G43580.1 (AT5G43580.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 70.1 bits (170), Expect = 6.2e-13 Identity = 36/71 (50.70%), Postives = 46/71 (64.79%), Query Frame = 1
BLAST of ClCG05G004550 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 64.3 bits (155), Expect = 3.4e-11 Identity = 34/67 (50.75%), Postives = 41/67 (61.19%), Query Frame = 1
BLAST of ClCG05G004550 vs. TAIR10
Match: AT5G43570.1 (AT5G43570.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 60.8 bits (146), Expect = 3.7e-10 Identity = 32/62 (51.61%), Postives = 37/62 (59.68%), Query Frame = 1
BLAST of ClCG05G004550 vs. TAIR10
Match: AT3G46860.1 (AT3G46860.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 53.5 bits (127), Expect = 6.0e-08 Identity = 31/66 (46.97%), Postives = 43/66 (65.15%), Query Frame = 1
BLAST of ClCG05G004550 vs. TAIR10
Match: AT2G38900.2 (AT2G38900.2 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 52.8 bits (125), Expect = 1.0e-07 Identity = 29/65 (44.62%), Postives = 35/65 (53.85%), Query Frame = 1
BLAST of ClCG05G004550 vs. NCBI nr
Match: gi|920692319|gb|KOM35544.1| (hypothetical protein LR48_Vigan02g169400 [Vigna angularis]) HSP 1 Score: 94.4 bits (233), Expect = 8.7e-17 Identity = 44/70 (62.86%), Postives = 54/70 (77.14%), Query Frame = 1
BLAST of ClCG05G004550 vs. NCBI nr
Match: gi|596296032|ref|XP_007227104.1| (hypothetical protein PRUPE_ppa025505mg [Prunus persica]) HSP 1 Score: 94.4 bits (233), Expect = 8.7e-17 Identity = 47/69 (68.12%), Postives = 53/69 (76.81%), Query Frame = 1
BLAST of ClCG05G004550 vs. NCBI nr
Match: gi|734352508|gb|KHN13145.1| (Glu S.griseus protease inhibitor [Glycine soja]) HSP 1 Score: 94.4 bits (233), Expect = 8.7e-17 Identity = 46/70 (65.71%), Postives = 54/70 (77.14%), Query Frame = 1
BLAST of ClCG05G004550 vs. NCBI nr
Match: gi|22759721|dbj|BAC10909.1| (protease inhibitor 1, partial [Zinnia violacea]) HSP 1 Score: 93.2 bits (230), Expect = 1.9e-16 Identity = 44/67 (65.67%), Postives = 47/67 (70.15%), Query Frame = 1
BLAST of ClCG05G004550 vs. NCBI nr
Match: gi|593686788|ref|XP_007144065.1| (hypothetical protein PHAVU_007G125500g [Phaseolus vulgaris]) HSP 1 Score: 93.2 bits (230), Expect = 1.9e-16 Identity = 43/67 (64.18%), Postives = 51/67 (76.12%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |