Cucsa.255000 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTCTCTGTGATGGTAAATAAATGCTCTTCATACTAACTATATGTTATATAAATAGTATATATGCAATGTGCACCTTTCTTACACCATGTCTTCTTTAGTAACTATTTTGGCTTTTGGTTTTTGTTTTTAAACACTACTTCCACTTTTTATTTTTCTTTCTTTCTTTCTTATCTATCCTGGTTTAAAAACCAAaTCAAaTTtAAAAATAAAAAaTATAATTTTAAAAaCTTGTTTGTGTTTATTTGGATTTGGTTAAGAATTTTACTGTCATATTTAAAAAaGATGCAATGGAGTGATCAAACGCAGCCCTAGTTATCTGTTTTGTTTTAAGTTTAATCTGTTGTTGTGATGAAAATTATAAGGTAAAACCTCATGGCCGGAGCTGATCGGAAAACATGGAAAGGTGGCGGAGGAAACGATAGAGAGAGAGGTTCCATGGGTAAATGCTAAGGTTGTCCAGGAAGGAACCACTTTTGTTACTGCTGATTATAATTGTAATAGGGTTTGGGTTTGGGTTAATAAACATGGCTTTGTTACTAGAATTCCCATTATTG ATGTCTCTCTGTGATGGTAAAACCTCATGGCCGGAGCTGATCGGAAAACATGGAAAGGTGGCGGAGGAAACGATAGAGAGAGAGGTTCCATGGGTAAATGCTAAGGTTGTCCAGGAAGGAACCACTTTTGTTACTGCTGATTATAATTGTAATAGGGTTTGGGTTTGGGTTAATAAACATGGCTTTGTTACTAGAATTCCCATTATTG ATGTCTCTCTGTGATGGTAAAACCTCATGGCCGGAGCTGATCGGAAAACATGGAAAGGTGGCGGAGGAAACGATAGAGAGAGAGGTTCCATGGGTAAATGCTAAGGTTGTCCAGGAAGGAACCACTTTTGTTACTGCTGATTATAATTGTAATAGGGTTTGGGTTTGGGTTAATAAACATGGCTTTGTTACTAGAATTCCCATTATTG MSLCDGKTSWPELIGKHGKVAEETIEREVPWVNAKVVQEGTTFVTADYNCNRVWVWVNKHGFVTRIPIIX
BLAST of Cucsa.255000 vs. Swiss-Prot
Match: ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum PE=1 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 5.8e-13 Identity = 35/66 (53.03%), Postives = 47/66 (71.21%), Query Frame = 1
BLAST of Cucsa.255000 vs. Swiss-Prot
Match: ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.3e-12 Identity = 36/68 (52.94%), Postives = 45/68 (66.18%), Query Frame = 1
BLAST of Cucsa.255000 vs. Swiss-Prot
Match: BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 8.4e-12 Identity = 35/68 (51.47%), Postives = 44/68 (64.71%), Query Frame = 1
BLAST of Cucsa.255000 vs. Swiss-Prot
Match: ICI1_SOLLC (Wound-induced proteinase inhibitor 1 OS=Solanum lycopersicum GN=PIIF PE=2 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.3e-08 Identity = 29/68 (42.65%), Postives = 46/68 (67.65%), Query Frame = 1
BLAST of Cucsa.255000 vs. Swiss-Prot
Match: ICIA_SOLTU (Chymotrypsin inhibitor I, A, B and C subunits OS=Solanum tuberosum PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 4.0e-06 Identity = 28/65 (43.08%), Postives = 41/65 (63.08%), Query Frame = 1
BLAST of Cucsa.255000 vs. TrEMBL
Match: A0A0S3SPN2_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.08G139400 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.5e-15 Identity = 42/69 (60.87%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Cucsa.255000 vs. TrEMBL
Match: A0A0L9TZF4_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan02g169400 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.5e-15 Identity = 42/69 (60.87%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Cucsa.255000 vs. TrEMBL
Match: V7BDZ6_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_007G125500g PE=4 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.3e-15 Identity = 40/66 (60.61%), Postives = 51/66 (77.27%), Query Frame = 1
BLAST of Cucsa.255000 vs. TrEMBL
Match: I1NI60_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_20G205900 PE=4 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.3e-15 Identity = 43/69 (62.32%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Cucsa.255000 vs. TrEMBL
Match: A0A0B2PVG1_GLYSO (Glu S.griseus protease inhibitor OS=Glycine soja GN=glysoja_040425 PE=4 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.3e-15 Identity = 43/69 (62.32%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Cucsa.255000 vs. TAIR10
Match: AT5G43580.1 (AT5G43580.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 68.6 bits (166), Expect = 1.8e-12 Identity = 35/70 (50.00%), Postives = 49/70 (70.00%), Query Frame = 1
BLAST of Cucsa.255000 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 60.1 bits (144), Expect = 6.4e-10 Identity = 31/64 (48.44%), Postives = 41/64 (64.06%), Query Frame = 1
BLAST of Cucsa.255000 vs. TAIR10
Match: AT5G43570.1 (AT5G43570.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 58.5 bits (140), Expect = 1.9e-09 Identity = 30/62 (48.39%), Postives = 40/62 (64.52%), Query Frame = 1
BLAST of Cucsa.255000 vs. TAIR10
Match: AT3G46860.1 (AT3G46860.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 53.1 bits (126), Expect = 7.8e-08 Identity = 28/63 (44.44%), Postives = 43/63 (68.25%), Query Frame = 1
BLAST of Cucsa.255000 vs. NCBI nr
Match: gi|920692319|gb|KOM35544.1| (hypothetical protein LR48_Vigan02g169400 [Vigna angularis]) HSP 1 Score: 89.7 bits (221), Expect = 2.1e-15 Identity = 42/69 (60.87%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Cucsa.255000 vs. NCBI nr
Match: gi|593686788|ref|XP_007144065.1| (hypothetical protein PHAVU_007G125500g [Phaseolus vulgaris]) HSP 1 Score: 88.6 bits (218), Expect = 4.8e-15 Identity = 40/66 (60.61%), Postives = 51/66 (77.27%), Query Frame = 1
BLAST of Cucsa.255000 vs. NCBI nr
Match: gi|734352508|gb|KHN13145.1| (Glu S.griseus protease inhibitor [Glycine soja]) HSP 1 Score: 88.2 bits (217), Expect = 6.2e-15 Identity = 43/69 (62.32%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Cucsa.255000 vs. NCBI nr
Match: gi|596296032|ref|XP_007227104.1| (hypothetical protein PRUPE_ppa025505mg [Prunus persica]) HSP 1 Score: 87.4 bits (215), Expect = 1.1e-14 Identity = 43/68 (63.24%), Postives = 51/68 (75.00%), Query Frame = 1
BLAST of Cucsa.255000 vs. NCBI nr
Match: gi|734352510|gb|KHN13147.1| (Proteinase inhibitor [Glycine soja]) HSP 1 Score: 87.0 bits (214), Expect = 1.4e-14 Identity = 40/66 (60.61%), Postives = 47/66 (71.21%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |