Carg06201 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAAAGAGAAAAAGATGTCTTCATGTCCAGGTAATAGACTCACAACTTATGATCCTCGCTTCTCTTTGTCTCTGTGTTTGTGTTTGTGTGTGTCTGAGGAGATGTGTTTTGGCGACCAGGGAAGAGCTCATGGCCGCATCTGGTGGGGTTGGGCGGCTCAGCCGCCAAGGCCATTATCGAGAGGGAGAATCCGAACGTGAAAGCCGTCATTTTGGAGGAGGGAACCCCCGTCACCAAGGACTTCCGCTGTAATCGGGTTCGAATTTGGGTCAATAAGCGTGGACTTGTTGCAAGCCCACCTCGAATAGGCTGAGGCCCAAGCCCAAGCCCAAGCCCAAAC AAAAGAGAAAAAGATGTCTTCATGTCCAGGGAAGAGCTCATGGCCGCATCTGGTGGGGTTGGGCGGCTCAGCCGCCAAGGCCATTATCGAGAGGGAGAATCCGAACGTGAAAGCCGTCATTTTGGAGGAGGGAACCCCCGTCACCAAGGACTTCCGCTGTAATCGGGTTCGAATTTGGGTCAATAAGCGTGGACTTGTTGCAAGCCCACCTCGAATAGGCTGAGGCCCAAGCCCAAGCCCAAGCCCAAAC ATGTCTTCATGTCCAGGGAAGAGCTCATGGCCGCATCTGGTGGGGTTGGGCGGCTCAGCCGCCAAGGCCATTATCGAGAGGGAGAATCCGAACGTGAAAGCCGTCATTTTGGAGGAGGGAACCCCCGTCACCAAGGACTTCCGCTGTAATCGGGTTCGAATTTGGGTCAATAAGCGTGGACTTGTTGCAAGCCCACCTCGAATAGGCTGA MSSCPGKSSWPHLVGLGGSAAKAIIERENPNVKAVILEEGTPVTKDFRCNRVRIWVNKRGLVASPPRIG
BLAST of Carg06201 vs. NCBI nr
Match: XP_022946028.1 (inhibitor of trypsin and hageman factor [Cucurbita moschata]) HSP 1 Score: 146.0 bits (367), Expect = 4.8e-32 Identity = 68/69 (98.55%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of Carg06201 vs. NCBI nr
Match: XP_022975284.1 (inhibitor of trypsin and hageman factor [Cucurbita maxima]) HSP 1 Score: 142.9 bits (359), Expect = 4.1e-31 Identity = 66/69 (95.65%), Postives = 67/69 (97.10%), Query Frame = 0
BLAST of Carg06201 vs. NCBI nr
Match: 1MIT_A (Chain A, RECOMBINANT CUCURBITA MAXIMA TRYPSIN INHIBITOR V (RCMTI-V) (NMR, MINIMIZED AVERAGE STRUCTURE)) HSP 1 Score: 139.8 bits (351), Expect = 3.4e-30 Identity = 64/68 (94.12%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of Carg06201 vs. NCBI nr
Match: 1TIN_A (Chain A, THREE-DIMENSIONAL STRUCTURE IN SOLUTION OF CUCURBITA MAXIMA TRYPSIN INHIBITOR-V DETERMINED BY NMR SPECTROSCOPY) HSP 1 Score: 139.8 bits (351), Expect = 3.4e-30 Identity = 64/68 (94.12%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of Carg06201 vs. NCBI nr
Match: P19873.1 (RecName: Full=Inhibitor of trypsin and hageman factor; AltName: Full=CMTI-V >prf||1701295A trypsin inhibitor) HSP 1 Score: 139.8 bits (351), Expect = 3.4e-30 Identity = 64/68 (94.12%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of Carg06201 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 80.1 bits (196), Expect = 5.9e-16 Identity = 33/68 (48.53%), Postives = 46/68 (67.65%), Query Frame = 0
BLAST of Carg06201 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 80.1 bits (196), Expect = 5.9e-16 Identity = 37/65 (56.92%), Postives = 46/65 (70.77%), Query Frame = 0
BLAST of Carg06201 vs. TAIR10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 66.2 bits (160), Expect = 8.8e-12 Identity = 31/63 (49.21%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of Carg06201 vs. TAIR10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 63.5 bits (153), Expect = 5.7e-11 Identity = 26/64 (40.62%), Postives = 41/64 (64.06%), Query Frame = 0
BLAST of Carg06201 vs. TAIR10
Match: AT3G50020.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 47.0 bits (110), Expect = 5.5e-06 Identity = 31/70 (44.29%), Postives = 38/70 (54.29%), Query Frame = 0
BLAST of Carg06201 vs. Swiss-Prot
Match: sp|P19873|ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 1.1e-32 Identity = 64/68 (94.12%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of Carg06201 vs. Swiss-Prot
Match: sp|P24076|BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 5.3e-22 Identity = 46/68 (67.65%), Postives = 55/68 (80.88%), Query Frame = 0
BLAST of Carg06201 vs. Swiss-Prot
Match: sp|P82381|ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 3.3e-16 Identity = 37/65 (56.92%), Postives = 49/65 (75.38%), Query Frame = 0
BLAST of Carg06201 vs. Swiss-Prot
Match: sp|Q6XNP7|HPI_HEVBR (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 79.0 bits (193), Expect = 2.4e-14 Identity = 34/68 (50.00%), Postives = 47/68 (69.12%), Query Frame = 0
BLAST of Carg06201 vs. Swiss-Prot
Match: sp|P80211|ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 3.1e-14 Identity = 35/65 (53.85%), Postives = 45/65 (69.23%), Query Frame = 0
BLAST of Carg06201 vs. TrEMBL
Match: tr|Q7M1Q1|Q7M1Q1_MOMCH (Trypsin inhibitor BGIT OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 1.4e-19 Identity = 46/68 (67.65%), Postives = 56/68 (82.35%), Query Frame = 0
BLAST of Carg06201 vs. TrEMBL
Match: tr|Q9AYN0|Q9AYN0_MOMCH (Inhibitor against trypsin (Fragment) OS=Momordica charantia OX=3673 GN=bgit PE=2 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.4e-19 Identity = 45/66 (68.18%), Postives = 55/66 (83.33%), Query Frame = 0
BLAST of Carg06201 vs. TrEMBL
Match: tr|A0A2P5VZ93|A0A2P5VZ93_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_AA36554 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.2e-18 Identity = 45/69 (65.22%), Postives = 52/69 (75.36%), Query Frame = 0
BLAST of Carg06201 vs. TrEMBL
Match: tr|A0A2U1NRK6|A0A2U1NRK6_ARTAN (Inhibitor of trypsin and hageman factor OS=Artemisia annua OX=35608 GN=CTI12_AA232000 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 2.0e-18 Identity = 44/69 (63.77%), Postives = 52/69 (75.36%), Query Frame = 0
BLAST of Carg06201 vs. TrEMBL
Match: tr|A0A2U1LC86|A0A2U1LC86_ARTAN (Proteinase inhibitor I13 OS=Artemisia annua OX=35608 GN=CTI12_AA505390 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 4.5e-18 Identity = 44/68 (64.71%), Postives = 51/68 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |