CmaCh14G017850 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexonthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTGTTTTTGCGATGGTTAAGGAAAGAGCTCATGGCCGGAGCTGGTGGGTAAGGAAGGCAAAGAAGCAGAGAGGATTATCGAGAAGGAGAATCCTTTGGTGGATGCCATTATTGTGGATGAAGGATCAAGTGTGATTCAAGACTTTAGGTGCGACAGGGTTTGGGTTTGGGTGACTGTGAAAACAGGCATCGTCACCAGGACTCCTTTCATTGGTTAACCATTTTAATCATAATATTGTGTGCTTCCAAATATATAAATCCCATCCATGTTTGTTCCCACAACATGAATATTCAATAAGGTGATTCTATCTTTCTTCTTCTTCTTTTTTTTTCTTATTAATGTACTCATCGTGTTTGTGGTAATAAAAATACTGCAATTTCATTTTCCGTTTATGCA ATGGGAAAGAGCTCATGGCCGGAGCTGGTGGGTAAGGAAGGCAAAGAAGCAGAGAGGATTATCGAGAAGGAGAATCCTTTGGTGGATGCCATTATTGTGGATGAAGGATCAAGTGTGATTCAAGACTTTAGGTGCGACAGGGTTTGGGTTTGGGTGACTGTGAAAACAGGCATCGTCACCAGGACTCCTTTCATTGGTTAACCATTTTAATCATAATATTGTGTGCTTCCAAATATATAAATCCCATCCATGTTTGTTCCCACAACATGAATATTCAATAAGGTGATTCTATCTTTCTTCTTCTTCTTTTTTTTTCTTATTAATGTACTCATCGTGTTTGTGGTAATAAAAATACTGCAATTTCATTTTCCGTTTATGCA ATGGGAAAGAGCTCATGGCCGGAGCTGGTGGGTAAGGAAGGCAAAGAAGCAGAGAGGATTATCGAGAAGGAGAATCCTTTGGTGGATGCCATTATTGTGGATGAAGGATCAAGTGTGATTCAAGACTTTAGGTGCGACAGGGTTTGGGTTTGGGTGACTGTGAAAACAGGCATCGTCACCAGGACTCCTTTCATTGGTTAA MGKSSWPELVGKEGKEAERIIEKENPLVDAIIVDEGSSVIQDFRCDRVWVWVTVKTGIVTRTPFIG
BLAST of CmaCh14G017850 vs. Swiss-Prot
Match: BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 2.9e-14 Identity = 40/65 (61.54%), Postives = 46/65 (70.77%), Query Frame = 1
BLAST of CmaCh14G017850 vs. Swiss-Prot
Match: ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 5.5e-13 Identity = 36/65 (55.38%), Postives = 47/65 (72.31%), Query Frame = 1
BLAST of CmaCh14G017850 vs. Swiss-Prot
Match: ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.6e-12 Identity = 36/62 (58.06%), Postives = 43/62 (69.35%), Query Frame = 1
BLAST of CmaCh14G017850 vs. Swiss-Prot
Match: ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.1e-12 Identity = 35/64 (54.69%), Postives = 45/64 (70.31%), Query Frame = 1
BLAST of CmaCh14G017850 vs. Swiss-Prot
Match: ITI_FAGTA (Trypsin inhibitor OS=Fagopyrum tataricum PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.8e-09 Identity = 32/70 (45.71%), Postives = 44/70 (62.86%), Query Frame = 1
BLAST of CmaCh14G017850 vs. TrEMBL
Match: A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.2e-24 Identity = 56/65 (86.15%), Postives = 58/65 (89.23%), Query Frame = 1
BLAST of CmaCh14G017850 vs. TrEMBL
Match: G7I4R6_MEDTR (Inhibitor of trypsin and hageman factor-like protein OS=Medicago truncatula GN=MTR_1g075410 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 6.7e-18 Identity = 49/65 (75.38%), Postives = 53/65 (81.54%), Query Frame = 1
BLAST of CmaCh14G017850 vs. TrEMBL
Match: B1ACD2_SOYBN (Putative protease inhibitor OS=Glycine max GN=GLYMA_10G184700 PE=2 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 7.4e-17 Identity = 46/65 (70.77%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of CmaCh14G017850 vs. TrEMBL
Match: A0A068TV46_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00026229001 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 7.4e-17 Identity = 46/65 (70.77%), Postives = 51/65 (78.46%), Query Frame = 1
BLAST of CmaCh14G017850 vs. TrEMBL
Match: A0A0B2P035_GLYSO (Inhibitor of trypsin and hageman factor OS=Glycine soja GN=glysoja_000750 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 7.4e-17 Identity = 46/65 (70.77%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of CmaCh14G017850 vs. TAIR10
Match: AT5G43580.1 (AT5G43580.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 71.2 bits (173), Expect = 2.6e-13 Identity = 33/65 (50.77%), Postives = 48/65 (73.85%), Query Frame = 1
BLAST of CmaCh14G017850 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 63.2 bits (152), Expect = 7.1e-11 Identity = 33/64 (51.56%), Postives = 42/64 (65.62%), Query Frame = 1
BLAST of CmaCh14G017850 vs. TAIR10
Match: AT5G43570.1 (AT5G43570.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 62.8 bits (151), Expect = 9.3e-11 Identity = 33/61 (54.10%), Postives = 42/61 (68.85%), Query Frame = 1
BLAST of CmaCh14G017850 vs. TAIR10
Match: AT2G38900.2 (AT2G38900.2 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 57.4 bits (137), Expect = 3.9e-09 Identity = 28/66 (42.42%), Postives = 41/66 (62.12%), Query Frame = 1
BLAST of CmaCh14G017850 vs. TAIR10
Match: AT3G46860.1 (AT3G46860.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 55.8 bits (133), Expect = 1.1e-08 Identity = 30/64 (46.88%), Postives = 41/64 (64.06%), Query Frame = 1
BLAST of CmaCh14G017850 vs. NCBI nr
Match: gi|659076233|ref|XP_008438570.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis melo]) HSP 1 Score: 120.6 bits (301), Expect = 1.1e-24 Identity = 57/65 (87.69%), Postives = 59/65 (90.77%), Query Frame = 1
BLAST of CmaCh14G017850 vs. NCBI nr
Match: gi|449432606|ref|XP_004134090.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]) HSP 1 Score: 119.0 bits (297), Expect = 3.1e-24 Identity = 56/65 (86.15%), Postives = 58/65 (89.23%), Query Frame = 1
BLAST of CmaCh14G017850 vs. NCBI nr
Match: gi|357441047|ref|XP_003590801.1| (inhibitor of trypsin and hageman factor-like protein [Medicago truncatula]) HSP 1 Score: 97.4 bits (241), Expect = 9.7e-18 Identity = 49/65 (75.38%), Postives = 53/65 (81.54%), Query Frame = 1
BLAST of CmaCh14G017850 vs. NCBI nr
Match: gi|351727373|ref|NP_001238694.1| (protease inhibitor-like [Glycine max]) HSP 1 Score: 94.0 bits (232), Expect = 1.1e-16 Identity = 46/65 (70.77%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of CmaCh14G017850 vs. NCBI nr
Match: gi|661897466|emb|CDO99178.1| (unnamed protein product [Coffea canephora]) HSP 1 Score: 94.0 bits (232), Expect = 1.1e-16 Identity = 46/65 (70.77%), Postives = 51/65 (78.46%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |