MELO3C006462.2 (gene) Melon (DHL92) v3.6.1
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCAAACTCATGCAAAGGTATATTATTATATCTTCAATATATACAAAAATTTAGCCTCTTTCTCTTTATCTTAATGGTTAGTTTTTATTTATTTGATGTGTGACACACAGGAAAGAGCTCATGGCCAGAGCTTGTTAATGCTCCAGCAGAAATTGCAGTCAAAATTATAGAGAAACAAAATAGTTCGGTTAAAGCCATTGTCGTTGAAGAAGGATCTTCTGTCGTCACCAACTTCGAGTGTGGTCGAGTTTTTGTTTTCGTCCACAAGAAGACCAATAACGTTACTAAGACCCCTCGCATCGGCTAA ATGCCAAACTCATGCAAAGGAAAGAGCTCATGGCCAGAGCTTGTTAATGCTCCAGCAGAAATTGCAGTCAAAATTATAGAGAAACAAAATAGTTCGGTTAAAGCCATTGTCGTTGAAGAAGGATCTTCTGTCGTCACCAACTTCGAGTGTGGTCGAGTTTTTGTTTTCGTCCACAAGAAGACCAATAACGTTACTAAGACCCCTCGCATCGGCTAA ATGCCAAACTCATGCAAAGGAAAGAGCTCATGGCCAGAGCTTGTTAATGCTCCAGCAGAAATTGCAGTCAAAATTATAGAGAAACAAAATAGTTCGGTTAAAGCCATTGTCGTTGAAGAAGGATCTTCTGTCGTCACCAACTTCGAGTGTGGTCGAGTTTTTGTTTTCGTCCACAAGAAGACCAATAACGTTACTAAGACCCCTCGCATCGGCTAA MPNSCKGKSSWPELVNAPAEIAVKIIEKQNSSVKAIVVEEGSSVVTNFECGRVFVFVHKKTNNVTKTPRIG
BLAST of MELO3C006462.2 vs. NCBI nr
Match: KGN56903.1 (hypothetical protein Csa_3G142950 [Cucumis sativus]) HSP 1 Score: 133.7 bits (335), Expect = 2.5e-28 Identity = 64/71 (90.14%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of MELO3C006462.2 vs. NCBI nr
Match: XP_004134090.1 (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus] >KGN56904.1 hypothetical protein Csa_3G142960 [Cucumis sativus]) HSP 1 Score: 82.8 bits (203), Expect = 5.1e-13 Identity = 41/71 (57.75%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of MELO3C006462.2 vs. NCBI nr
Match: XP_016898985.1 (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 80.5 bits (197), Expect = 2.6e-12 Identity = 41/71 (57.75%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of MELO3C006462.2 vs. NCBI nr
Match: KGN56905.1 (hypothetical protein Csa_3G142970 [Cucumis sativus]) HSP 1 Score: 79.3 bits (194), Expect = 5.7e-12 Identity = 41/71 (57.75%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of MELO3C006462.2 vs. NCBI nr
Match: OVA05297.1 (Proteinase inhibitor I13 [Macleaya cordata]) HSP 1 Score: 74.3 bits (181), Expect = 1.8e-10 Identity = 40/71 (56.34%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of MELO3C006462.2 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 56.6 bits (135), Expect = 7.2e-09 Identity = 30/71 (42.25%), Postives = 40/71 (56.34%), Query Frame = 0
BLAST of MELO3C006462.2 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 53.9 bits (128), Expect = 4.6e-08 Identity = 28/65 (43.08%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of MELO3C006462.2 vs. TAIR10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 46.6 bits (109), Expect = 7.4e-06 Identity = 24/65 (36.92%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of MELO3C006462.2 vs. Swiss-Prot
Match: sp|P19873|ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.5e-11 Identity = 34/69 (49.28%), Postives = 47/69 (68.12%), Query Frame = 0
BLAST of MELO3C006462.2 vs. Swiss-Prot
Match: sp|Q6XNP7|HPI_HEVBR (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 57.4 bits (137), Expect = 7.6e-08 Identity = 32/71 (45.07%), Postives = 44/71 (61.97%), Query Frame = 0
BLAST of MELO3C006462.2 vs. Swiss-Prot
Match: sp|P82381|ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 7.6e-08 Identity = 28/66 (42.42%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of MELO3C006462.2 vs. Swiss-Prot
Match: sp|P24076|BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 9.9e-08 Identity = 28/69 (40.58%), Postives = 43/69 (62.32%), Query Frame = 0
BLAST of MELO3C006462.2 vs. Swiss-Prot
Match: sp|P16231|ICI1_SOLPE (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.4e-06 Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 0
BLAST of MELO3C006462.2 vs. TrEMBL
Match: tr|A0A0A0L593|A0A0A0L593_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142950 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 1.7e-28 Identity = 64/71 (90.14%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of MELO3C006462.2 vs. TrEMBL
Match: tr|A0A0A0L795|A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 3.4e-13 Identity = 41/71 (57.75%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of MELO3C006462.2 vs. TrEMBL
Match: tr|A0A1S4DTF7|A0A1S4DTF7_CUCME (inhibitor of trypsin and hageman factor-like OS=Cucumis melo OX=3656 GN=LOC103483638 PE=4 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.7e-12 Identity = 41/71 (57.75%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of MELO3C006462.2 vs. TrEMBL
Match: tr|A0A0A0L4J0|A0A0A0L4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142970 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 3.8e-12 Identity = 41/71 (57.75%), Postives = 48/71 (67.61%), Query Frame = 0
BLAST of MELO3C006462.2 vs. TrEMBL
Match: tr|A0A200Q4H8|A0A200Q4H8_9MAGN (Proteinase inhibitor I13 OS=Macleaya cordata OX=56857 GN=BVC80_441g39 PE=4 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 1.2e-10 Identity = 40/71 (56.34%), Postives = 48/71 (67.61%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon v3.6.1
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |