CmaCh15G004760 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGGAAGAAAGAAGAAGGCTGTGCAGAAGGGAAGTACGCGACTCGTCGTCGGCTTGCAGTAGGAGACCAGCAACGGCGTCGTTTAAGCAGAGATGCAGTTTACTGGTGAAGGAGCAGAGAGCTAGGTTTTACATTCTTCGCCGATGTGTCGTAATGCTCGTGTGTTGGAATTACTATGCTGACCCTTGA ATGATGGAAGAAAGAAGAAGGCTGTGCAGAAGGGAAGTACGCGACTCGTCGTCGGCTTGCAGTAGGAGACCAGCAACGGCGTCGTTTAAGCAGAGATGCAGTTTACTGGTGAAGGAGCAGAGAGCTAGGTTTTACATTCTTCGCCGATGTGTCGTAATGCTCGTGTGTTGGAATTACTATGCTGACCCTTGA ATGATGGAAGAAAGAAGAAGGCTGTGCAGAAGGGAAGTACGCGACTCGTCGTCGGCTTGCAGTAGGAGACCAGCAACGGCGTCGTTTAAGCAGAGATGCAGTTTACTGGTGAAGGAGCAGAGAGCTAGGTTTTACATTCTTCGCCGATGTGTCGTAATGCTCGTGTGTTGGAATTACTATGCTGACCCTTGA MMEERRRLCRREVRDSSSACSRRPATASFKQRCSLLVKEQRARFYILRRCVVMLVCWNYYADP
BLAST of CmaCh15G004760 vs. TrEMBL
Match: B9HLH7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s03580g PE=4 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 1.3e-07 Identity = 34/63 (53.97%), Postives = 39/63 (61.90%), Query Frame = 1
BLAST of CmaCh15G004760 vs. TrEMBL
Match: K7NN29_PINTA (Uncharacterized protein (Fragment) OS=Pinus taeda GN=2_3237_01 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.8e-07 Identity = 29/42 (69.05%), Postives = 33/42 (78.57%), Query Frame = 1
BLAST of CmaCh15G004760 vs. TrEMBL
Match: A0A0K9PXY3_ZOSMR (ROTUNDIFOLIA like 8 OS=Zostera marina GN=ZOSMA_13G01210 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.3e-07 Identity = 27/39 (69.23%), Postives = 32/39 (82.05%), Query Frame = 1
BLAST of CmaCh15G004760 vs. TrEMBL
Match: W9R2B1_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_025336 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.3e-07 Identity = 32/55 (58.18%), Postives = 39/55 (70.91%), Query Frame = 1
BLAST of CmaCh15G004760 vs. TrEMBL
Match: M5X652_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa024599mg PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 6.7e-07 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 1
BLAST of CmaCh15G004760 vs. TAIR10
Match: AT2G39705.1 (AT2G39705.1 ROTUNDIFOLIA like 8) HSP 1 Score: 57.0 bits (136), Expect = 4.9e-09 Identity = 28/57 (49.12%), Postives = 40/57 (70.18%), Query Frame = 1
BLAST of CmaCh15G004760 vs. TAIR10
Match: AT2G29125.1 (AT2G29125.1 ROTUNDIFOLIA like 2) HSP 1 Score: 53.5 bits (127), Expect = 5.4e-08 Identity = 30/57 (52.63%), Postives = 37/57 (64.91%), Query Frame = 1
BLAST of CmaCh15G004760 vs. TAIR10
Match: AT3G55515.1 (AT3G55515.1 ROTUNDIFOLIA like 7) HSP 1 Score: 52.8 bits (125), Expect = 9.2e-08 Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 1
BLAST of CmaCh15G004760 vs. TAIR10
Match: AT2G36985.1 (AT2G36985.1 DVL family protein) HSP 1 Score: 51.6 bits (122), Expect = 2.0e-07 Identity = 21/31 (67.74%), Postives = 28/31 (90.32%), Query Frame = 1
BLAST of CmaCh15G004760 vs. TAIR10
Match: AT3G14362.1 (AT3G14362.1 ROTUNDIFOLIA like 10) HSP 1 Score: 48.1 bits (113), Expect = 2.3e-06 Identity = 21/35 (60.00%), Postives = 24/35 (68.57%), Query Frame = 1
BLAST of CmaCh15G004760 vs. NCBI nr
Match: gi|659113321|ref|XP_008456514.1| (PREDICTED: uncharacterized protein LOC103496443 [Cucumis melo]) HSP 1 Score: 103.6 bits (257), Expect = 1.3e-19 Identity = 54/63 (85.71%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of CmaCh15G004760 vs. NCBI nr
Match: gi|719993720|ref|XP_010253964.1| (PREDICTED: uncharacterized protein LOC104595084 [Nelumbo nucifera]) HSP 1 Score: 67.4 bits (163), Expect = 1.0e-08 Identity = 35/49 (71.43%), Postives = 37/49 (75.51%), Query Frame = 1
BLAST of CmaCh15G004760 vs. NCBI nr
Match: gi|566182182|ref|XP_002311997.2| (hypothetical protein POPTR_0008s03580g [Populus trichocarpa]) HSP 1 Score: 63.2 bits (152), Expect = 1.9e-07 Identity = 34/63 (53.97%), Postives = 39/63 (61.90%), Query Frame = 1
BLAST of CmaCh15G004760 vs. NCBI nr
Match: gi|367066086|gb|AEX12455.1| (hypothetical protein 2_3237_01, partial [Pinus taeda]) HSP 1 Score: 62.8 bits (151), Expect = 2.5e-07 Identity = 29/42 (69.05%), Postives = 33/42 (78.57%), Query Frame = 1
BLAST of CmaCh15G004760 vs. NCBI nr
Match: gi|703099220|ref|XP_010096589.1| (hypothetical protein L484_025336 [Morus notabilis]) HSP 1 Score: 62.4 bits (150), Expect = 3.3e-07 Identity = 32/55 (58.18%), Postives = 39/55 (70.91%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|