Cp4.1LG01g24470 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGGAAGAAAGAAGAAGGCTGTGCAAGAGGGAAGTGAGAGGCTCATCGTCTTCAACCTGCTGCAGTAGTAGGAGGAGGAGATCGGGAACGGCGTCGTTTAAGCAGAGATGCAGTTTGCTTGTTAAGGAACAGAGAGCAAGGTTTTACATCCTCCGCCGATGTGTCGTCATGCTCGTCTGCTGGCATTACTACGCCGACCCTTAA ATGATGGAAGAAAGAAGAAGGCTGTGCAAGAGGGAAGTGAGAGGCTCATCGTCTTCAACCTGCTGCAGTAGTAGGAGGAGGAGATCGGGAACGGCGTCGTTTAAGCAGAGATGCAGTTTGCTTGTTAAGGAACAGAGAGCAAGGTTTTACATCCTCCGCCGATGTGTCGTCATGCTCGTCTGCTGGCATTACTACGCCGACCCTTAA ATGATGGAAGAAAGAAGAAGGCTGTGCAAGAGGGAAGTGAGAGGCTCATCGTCTTCAACCTGCTGCAGTAGTAGGAGGAGGAGATCGGGAACGGCGTCGTTTAAGCAGAGATGCAGTTTGCTTGTTAAGGAACAGAGAGCAAGGTTTTACATCCTCCGCCGATGTGTCGTCATGCTCGTCTGCTGGCATTACTACGCCGACCCTTAA MMEERRRLCKREVRGSSSSTCCSSRRRRSGTASFKQRCSLLVKEQRARFYILRRCVVMLVCWHYYADP
BLAST of Cp4.1LG01g24470 vs. TrEMBL
Match: B9HLH7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s03580g PE=4 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-07 Identity = 31/45 (68.89%), Postives = 34/45 (75.56%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. TrEMBL
Match: A0A0A0KQA4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G182670 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.4e-07 Identity = 36/69 (52.17%), Postives = 45/69 (65.22%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. TrEMBL
Match: A0A0D2S6S2_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G021600 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.5e-07 Identity = 37/75 (49.33%), Postives = 49/75 (65.33%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. TrEMBL
Match: A0A059ADQ2_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_J01236 PE=4 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.2e-07 Identity = 39/75 (52.00%), Postives = 50/75 (66.67%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. TrEMBL
Match: A5BGF1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_024942 PE=4 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 4.2e-07 Identity = 33/66 (50.00%), Postives = 44/66 (66.67%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. TAIR10
Match: AT2G39705.1 (AT2G39705.1 ROTUNDIFOLIA like 8) HSP 1 Score: 57.0 bits (136), Expect = 5.3e-09 Identity = 29/66 (43.94%), Postives = 47/66 (71.21%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. TAIR10
Match: AT3G55515.1 (AT3G55515.1 ROTUNDIFOLIA like 7) HSP 1 Score: 54.7 bits (130), Expect = 2.6e-08 Identity = 29/58 (50.00%), Postives = 40/58 (68.97%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. TAIR10
Match: AT2G36985.1 (AT2G36985.1 DVL family protein) HSP 1 Score: 53.5 bits (127), Expect = 5.8e-08 Identity = 22/31 (70.97%), Postives = 28/31 (90.32%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. TAIR10
Match: AT2G29125.1 (AT2G29125.1 ROTUNDIFOLIA like 2) HSP 1 Score: 53.1 bits (126), Expect = 7.6e-08 Identity = 30/55 (54.55%), Postives = 37/55 (67.27%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. TAIR10
Match: AT5G59510.1 (AT5G59510.1 ROTUNDIFOLIA like 5) HSP 1 Score: 50.4 bits (119), Expect = 4.9e-07 Identity = 27/57 (47.37%), Postives = 37/57 (64.91%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. NCBI nr
Match: gi|659113321|ref|XP_008456514.1| (PREDICTED: uncharacterized protein LOC103496443 [Cucumis melo]) HSP 1 Score: 97.8 bits (242), Expect = 7.6e-18 Identity = 54/68 (79.41%), Postives = 57/68 (83.82%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. NCBI nr
Match: gi|657996031|ref|XP_008390376.1| (PREDICTED: uncharacterized protein LOC103452634 [Malus domestica]) HSP 1 Score: 67.0 bits (162), Expect = 1.4e-08 Identity = 35/58 (60.34%), Postives = 41/58 (70.69%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. NCBI nr
Match: gi|694448961|ref|XP_009350239.1| (PREDICTED: uncharacterized protein LOC103941774 [Pyrus x bretschneideri]) HSP 1 Score: 66.2 bits (160), Expect = 2.5e-08 Identity = 35/55 (63.64%), Postives = 39/55 (70.91%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. NCBI nr
Match: gi|719993720|ref|XP_010253964.1| (PREDICTED: uncharacterized protein LOC104595084 [Nelumbo nucifera]) HSP 1 Score: 63.9 bits (154), Expect = 1.2e-07 Identity = 34/51 (66.67%), Postives = 36/51 (70.59%), Query Frame = 1
BLAST of Cp4.1LG01g24470 vs. NCBI nr
Match: gi|566182182|ref|XP_002311997.2| (hypothetical protein POPTR_0008s03580g [Populus trichocarpa]) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-07 Identity = 31/45 (68.89%), Postives = 34/45 (75.56%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |