Carg02420 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGGAAGAAAGAAGAAGGCTGTGCAGGGGGGAAGTACGCGACTCGTCGTCGGCTTGCAGTAGGAGATCAGCAACGGCGTCGTTTAAGCAGAGATGCAGTTTACTGGTGAAGGAGCAGAGAGCTAGGTTTTACATTCTTCGCCGATGTGTCGTCATGCTCGTGTGTTGGAATTACTATGCTGACCCTTGA ATGATGGAAGAAAGAAGAAGGCTGTGCAGGGGGGAAGTACGCGACTCGTCGTCGGCTTGCAGTAGGAGATCAGCAACGGCGTCGTTTAAGCAGAGATGCAGTTTACTGGTGAAGGAGCAGAGAGCTAGGTTTTACATTCTTCGCCGATGTGTCGTCATGCTCGTGTGTTGGAATTACTATGCTGACCCTTGA ATGATGGAAGAAAGAAGAAGGCTGTGCAGGGGGGAAGTACGCGACTCGTCGTCGGCTTGCAGTAGGAGATCAGCAACGGCGTCGTTTAAGCAGAGATGCAGTTTACTGGTGAAGGAGCAGAGAGCTAGGTTTTACATTCTTCGCCGATGTGTCGTCATGCTCGTGTGTTGGAATTACTATGCTGACCCTTGA MMEERRRLCRGEVRDSSSACSRRSATASFKQRCSLLVKEQRARFYILRRCVVMLVCWNYYADP
BLAST of Carg02420 vs. NCBI nr
Match: OAY38885.1 (hypothetical protein MANES_10G049900 [Manihot esculenta]) HSP 1 Score: 65.1 bits (157), Expect = 9.9e-08 Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 0
BLAST of Carg02420 vs. NCBI nr
Match: PNT22514.1 (hypothetical protein POPTR_008G035900v3 [Populus trichocarpa]) HSP 1 Score: 62.8 bits (151), Expect = 4.9e-07 Identity = 31/52 (59.62%), Postives = 39/52 (75.00%), Query Frame = 0
BLAST of Carg02420 vs. NCBI nr
Match: PON42568.1 (DEVIL-like protein [Trema orientalis]) HSP 1 Score: 62.0 bits (149), Expect = 8.3e-07 Identity = 31/53 (58.49%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of Carg02420 vs. NCBI nr
Match: PIA26735.1 (hypothetical protein AQUCO_09000003v1 [Aquilegia coerulea]) HSP 1 Score: 61.2 bits (147), Expect = 1.4e-06 Identity = 31/46 (67.39%), Postives = 36/46 (78.26%), Query Frame = 0
BLAST of Carg02420 vs. NCBI nr
Match: PSR98012.1 (hypothetical protein CEY00_Acc24600 [Actinidia chinensis var. chinensis]) HSP 1 Score: 61.2 bits (147), Expect = 1.4e-06 Identity = 32/50 (64.00%), Postives = 38/50 (76.00%), Query Frame = 0
BLAST of Carg02420 vs. TAIR10
Match: AT2G39705.1 (ROTUNDIFOLIA like 8) HSP 1 Score: 57.8 bits (138), Expect = 2.9e-09 Identity = 28/57 (49.12%), Postives = 40/57 (70.18%), Query Frame = 0
BLAST of Carg02420 vs. TAIR10
Match: AT3G55515.1 (ROTUNDIFOLIA like 7) HSP 1 Score: 51.6 bits (122), Expect = 2.0e-07 Identity = 23/47 (48.94%), Postives = 33/47 (70.21%), Query Frame = 0
BLAST of Carg02420 vs. TAIR10
Match: AT2G36985.1 (DVL family protein) HSP 1 Score: 51.2 bits (121), Expect = 2.7e-07 Identity = 21/31 (67.74%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Carg02420 vs. TAIR10
Match: AT2G29125.1 (ROTUNDIFOLIA like 2) HSP 1 Score: 48.9 bits (115), Expect = 1.3e-06 Identity = 21/32 (65.62%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of Carg02420 vs. TAIR10
Match: AT1G53708.1 (ROTUNDIFOLIA like 9) HSP 1 Score: 48.1 bits (113), Expect = 2.3e-06 Identity = 21/35 (60.00%), Postives = 24/35 (68.57%), Query Frame = 0
BLAST of Carg02420 vs. TrEMBL
Match: tr|A0A2C9V3J5|A0A2C9V3J5_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_10G049900 PE=4 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 6.5e-08 Identity = 31/51 (60.78%), Postives = 40/51 (78.43%), Query Frame = 0
BLAST of Carg02420 vs. TrEMBL
Match: tr|B9HLH7|B9HLH7_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_008G035900v3 PE=4 SV=2) HSP 1 Score: 62.8 bits (151), Expect = 3.2e-07 Identity = 31/52 (59.62%), Postives = 39/52 (75.00%), Query Frame = 0
BLAST of Carg02420 vs. TrEMBL
Match: tr|A0A2P5B186|A0A2P5B186_9ROSA (DEVIL-like protein OS=Trema orientalis OX=63057 GN=TorDVL8 PE=4 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 5.5e-07 Identity = 31/53 (58.49%), Postives = 38/53 (71.70%), Query Frame = 0
BLAST of Carg02420 vs. TrEMBL
Match: tr|M0TCK0|M0TCK0_MUSAM (Uncharacterized protein OS=Musa acuminata subsp. malaccensis OX=214687 PE=4 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 5.5e-07 Identity = 28/40 (70.00%), Postives = 34/40 (85.00%), Query Frame = 0
BLAST of Carg02420 vs. TrEMBL
Match: tr|A0A2G5C619|A0A2G5C619_AQUCA (Uncharacterized protein OS=Aquilegia coerulea OX=218851 GN=AQUCO_09000003v1 PE=4 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 9.4e-07 Identity = 31/46 (67.39%), Postives = 36/46 (78.26%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|