Cla97C08G150430 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTGAAGAAAGAAGAAGGCTATGCAAGAGGGAATCATCGGCTTGCAGTAGGAGATCATCGGGAACGGCGTCGTTTAAGCAGAGGTGCAGTTTGCTTGTGAAGGAGCAGAGAGCGAGGTTTTACATTCTTCGCCGATGTGTCGTCATGCTCGTCTGTTGGAATTACTATGCTGACCCTTGA ATGAGTGAAGAAAGAAGAAGGCTATGCAAGAGGGAATCATCGGCTTGCAGTAGGAGATCATCGGGAACGGCGTCGTTTAAGCAGAGGTGCAGTTTGCTTGTGAAGGAGCAGAGAGCGAGGTTTTACATTCTTCGCCGATGTGTCGTCATGCTCGTCTGTTGGAATTACTATGCTGACCCTTGA ATGAGTGAAGAAAGAAGAAGGCTATGCAAGAGGGAATCATCGGCTTGCAGTAGGAGATCATCGGGAACGGCGTCGTTTAAGCAGAGGTGCAGTTTGCTTGTGAAGGAGCAGAGAGCGAGGTTTTACATTCTTCGCCGATGTGTCGTCATGCTCGTCTGTTGGAATTACTATGCTGACCCTTGA MSEERRRLCKRESSACSRRSSGTASFKQRCSLLVKEQRARFYILRRCVVMLVCWNYYADP
BLAST of Cla97C08G150430 vs. NCBI nr
Match: PNT22514.1 (hypothetical protein POPTR_008G035900v3 [Populus trichocarpa]) HSP 1 Score: 62.4 bits (150), Expect = 6.1e-07 Identity = 28/36 (77.78%), Postives = 31/36 (86.11%), Query Frame = 0
BLAST of Cla97C08G150430 vs. NCBI nr
Match: XP_023737243.1 (uncharacterized protein LOC111885195 [Lactuca sativa] >PLY71137.1 hypothetical protein LSAT_9X64901 [Lactuca sativa]) HSP 1 Score: 61.6 bits (148), Expect = 1.0e-06 Identity = 34/63 (53.97%), Postives = 45/63 (71.43%), Query Frame = 0
BLAST of Cla97C08G150430 vs. NCBI nr
Match: AEX12455.1 (hypothetical protein 2_3237_01, partial [Pinus taeda] >AEX12456.1 hypothetical protein 2_3237_01, partial [Pinus taeda] >AEX12457.1 hypothetical protein 2_3237_01, partial [Pinus taeda] >AEX12458.1 hypothetical protein 2_3237_01, partial [Pinus taeda] >AEX12459.1 hypothetical protein 2_3237_01, partial [Pinus taeda]) HSP 1 Score: 61.2 bits (147), Expect = 1.4e-06 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 0
BLAST of Cla97C08G150430 vs. NCBI nr
Match: KMZ59212.1 (ROTUNDIFOLIA like 8 [Zostera marina]) HSP 1 Score: 60.5 bits (145), Expect = 2.3e-06 Identity = 25/35 (71.43%), Postives = 30/35 (85.71%), Query Frame = 0
BLAST of Cla97C08G150430 vs. NCBI nr
Match: OAY38611.1 (hypothetical protein MANES_10G028700 [Manihot esculenta]) HSP 1 Score: 60.5 bits (145), Expect = 2.3e-06 Identity = 33/66 (50.00%), Postives = 45/66 (68.18%), Query Frame = 0
BLAST of Cla97C08G150430 vs. TrEMBL
Match: tr|B9HLH7|B9HLH7_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_008G035900v3 PE=4 SV=2) HSP 1 Score: 62.4 bits (150), Expect = 4.0e-07 Identity = 28/36 (77.78%), Postives = 31/36 (86.11%), Query Frame = 0
BLAST of Cla97C08G150430 vs. TrEMBL
Match: tr|A0A2J6K821|A0A2J6K821_LACSA (Uncharacterized protein OS=Lactuca sativa OX=4236 GN=LSAT_9X64901 PE=4 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 6.9e-07 Identity = 34/63 (53.97%), Postives = 45/63 (71.43%), Query Frame = 0
BLAST of Cla97C08G150430 vs. TrEMBL
Match: tr|K7NN29|K7NN29_PINTA (Uncharacterized protein (Fragment) OS=Pinus taeda OX=3352 GN=2_3237_01 PE=4 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 9.0e-07 Identity = 27/36 (75.00%), Postives = 31/36 (86.11%), Query Frame = 0
BLAST of Cla97C08G150430 vs. TrEMBL
Match: tr|A0A1S8ADH2|A0A1S8ADH2_CITLI (DVL family protein OS=Citrus limon OX=2708 PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.2e-06 Identity = 30/38 (78.95%), Postives = 32/38 (84.21%), Query Frame = 0
BLAST of Cla97C08G150430 vs. TrEMBL
Match: tr|A0A0K9NT44|A0A0K9NT44_ZOSMR (ROTUNDIFOLIA like 8 OS=Zostera marina OX=29655 GN=ZOSMA_6G01450 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.5e-06 Identity = 25/35 (71.43%), Postives = 30/35 (85.71%), Query Frame = 0
BLAST of Cla97C08G150430 vs. TAIR10
Match: AT2G39705.1 (ROTUNDIFOLIA like 8) HSP 1 Score: 56.2 bits (134), Expect = 7.9e-09 Identity = 27/54 (50.00%), Postives = 39/54 (72.22%), Query Frame = 0
BLAST of Cla97C08G150430 vs. TAIR10
Match: AT3G55515.1 (ROTUNDIFOLIA like 7) HSP 1 Score: 56.2 bits (134), Expect = 7.9e-09 Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 0
BLAST of Cla97C08G150430 vs. TAIR10
Match: AT2G36985.1 (DVL family protein) HSP 1 Score: 51.6 bits (122), Expect = 1.9e-07 Identity = 21/31 (67.74%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of Cla97C08G150430 vs. TAIR10
Match: AT2G29125.1 (ROTUNDIFOLIA like 2) HSP 1 Score: 49.3 bits (116), Expect = 9.7e-07 Identity = 21/32 (65.62%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of Cla97C08G150430 vs. TAIR10
Match: AT1G53708.1 (ROTUNDIFOLIA like 9) HSP 1 Score: 48.1 bits (113), Expect = 2.2e-06 Identity = 21/35 (60.00%), Postives = 24/35 (68.57%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |