CmaCh06G012630 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGAAATCTCTCGGAGCTCTTCTCAGGACAGCAACAATGGCCGCAAAACCTTCAAAATCGATCGATGATGAAATCTCTCGGAGCTCTTCTCAGGACAGCAACAATGGCCGCAAAACCTTAACGAACAGAGGAACGGCCTGCCGATACAGAGGCGTGAGGCAGAGAAAATGGGGAAAATGGGCGGCTGAAATTCGAGATCCCTTCAAGAGAGCTCGTATTTGGCTCGGAACTTACAATACTGCTGAGGAAGCTTCTAGGGTTTACGAATCGAAGCGGCTCGAGTTCCAGACCGCCATGGCCGCCGCCGCCGCCCCAAAACCTCCAGCAGGTTCAAAGCTTCTCATCTGTTAA ATGATGAAATCTCTCGGAGCTCTTCTCAGGACAGCAACAATGGCCGCAAAACCTTCAAAATCGATCGATGATGAAATCTCTCGGAGCTCTTCTCAGGACAGCAACAATGGCCGCAAAACCTTAACGAACAGAGGAACGGCCTGCCGATACAGAGGCGTGAGGCAGAGAAAATGGGGAAAATGGGCGGCTGAAATTCGAGATCCCTTCAAGAGAGCTCGTATTTGGCTCGGAACTTACAATACTGCTGAGGAAGCTTCTAGGGTTTACGAATCGAAGCGGCTCGAGTTCCAGACCGCCATGGCCGCCGCCGCCGCCCCAAAACCTCCAGCAGGTTCAAAGCTTCTCATCTGTTAA ATGATGAAATCTCTCGGAGCTCTTCTCAGGACAGCAACAATGGCCGCAAAACCTTCAAAATCGATCGATGATGAAATCTCTCGGAGCTCTTCTCAGGACAGCAACAATGGCCGCAAAACCTTAACGAACAGAGGAACGGCCTGCCGATACAGAGGCGTGAGGCAGAGAAAATGGGGAAAATGGGCGGCTGAAATTCGAGATCCCTTCAAGAGAGCTCGTATTTGGCTCGGAACTTACAATACTGCTGAGGAAGCTTCTAGGGTTTACGAATCGAAGCGGCTCGAGTTCCAGACCGCCATGGCCGCCGCCGCCGCCCCAAAACCTCCAGCAGGTTCAAAGCTTCTCATCTGTTAA MMKSLGALLRTATMAAKPSKSIDDEISRSSSQDSNNGRKTLTNRGTACRYRGVRQRKWGKWAAEIRDPFKRARIWLGTYNTAEEASRVYESKRLEFQTAMAAAAAPKPPAGSKLLIC
BLAST of CmaCh06G012630 vs. Swiss-Prot
Match: ERF76_ARATH (Ethylene-responsive transcription factor 11 OS=Arabidopsis thaliana GN=ERF11 PE=2 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.2e-15 Identity = 37/65 (56.92%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of CmaCh06G012630 vs. Swiss-Prot
Match: EF118_ARATH (Ethylene-responsive transcription factor ERF118 OS=Arabidopsis thaliana GN=ERF118 PE=2 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.6e-15 Identity = 44/88 (50.00%), Postives = 61/88 (69.32%), Query Frame = 1
BLAST of CmaCh06G012630 vs. Swiss-Prot
Match: EF112_ARATH (Ethylene-responsive transcription factor ERF112 OS=Arabidopsis thaliana GN=ERF112 PE=2 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 5.2e-14 Identity = 43/87 (49.43%), Postives = 55/87 (63.22%), Query Frame = 1
BLAST of CmaCh06G012630 vs. Swiss-Prot
Match: ABR1_ARATH (Ethylene-responsive transcription factor ABR1 OS=Arabidopsis thaliana GN=ABR1 PE=2 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 6.7e-14 Identity = 36/59 (61.02%), Postives = 43/59 (72.88%), Query Frame = 1
BLAST of CmaCh06G012630 vs. Swiss-Prot
Match: CRF1_ARATH (Ethylene-responsive transcription factor CRF1 OS=Arabidopsis thaliana GN=CRF1 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.0e-13 Identity = 34/61 (55.74%), Postives = 46/61 (75.41%), Query Frame = 1
BLAST of CmaCh06G012630 vs. TrEMBL
Match: A0A0A0L811_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G133130 PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 3.5e-25 Identity = 73/122 (59.84%), Postives = 83/122 (68.03%), Query Frame = 1
BLAST of CmaCh06G012630 vs. TrEMBL
Match: A0A0A0K880_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G039270 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 1.0e-24 Identity = 68/99 (68.69%), Postives = 76/99 (76.77%), Query Frame = 1
BLAST of CmaCh06G012630 vs. TrEMBL
Match: W9RLP9_9ROSA (Ethylene-responsive transcription factor OS=Morus notabilis GN=L484_014665 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 2.2e-19 Identity = 62/104 (59.62%), Postives = 72/104 (69.23%), Query Frame = 1
BLAST of CmaCh06G012630 vs. TrEMBL
Match: A0A118K322_CYNCS (AP2/ERF domain-containing protein OS=Cynara cardunculus var. scolymus GN=Ccrd_016351 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.7e-19 Identity = 56/91 (61.54%), Postives = 65/91 (71.43%), Query Frame = 1
BLAST of CmaCh06G012630 vs. TrEMBL
Match: F6HEX1_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0011g03470 PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 6.3e-19 Identity = 54/94 (57.45%), Postives = 67/94 (71.28%), Query Frame = 1
BLAST of CmaCh06G012630 vs. TAIR10
Match: AT1G28370.1 (AT1G28370.1 ERF domain protein 11) HSP 1 Score: 84.0 bits (206), Expect = 6.9e-17 Identity = 37/65 (56.92%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of CmaCh06G012630 vs. TAIR10
Match: AT1G68550.1 (AT1G68550.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 83.6 bits (205), Expect = 9.0e-17 Identity = 44/88 (50.00%), Postives = 61/88 (69.32%), Query Frame = 1
BLAST of CmaCh06G012630 vs. TAIR10
Match: AT2G33710.2 (AT2G33710.2 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 78.6 bits (192), Expect = 2.9e-15 Identity = 43/87 (49.43%), Postives = 55/87 (63.22%), Query Frame = 1
BLAST of CmaCh06G012630 vs. TAIR10
Match: AT5G64750.1 (AT5G64750.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 78.2 bits (191), Expect = 3.8e-15 Identity = 36/59 (61.02%), Postives = 43/59 (72.88%), Query Frame = 1
BLAST of CmaCh06G012630 vs. TAIR10
Match: AT4G11140.1 (AT4G11140.1 cytokinin response factor 1) HSP 1 Score: 76.6 bits (187), Expect = 1.1e-14 Identity = 34/61 (55.74%), Postives = 46/61 (75.41%), Query Frame = 1
BLAST of CmaCh06G012630 vs. NCBI nr
Match: gi|659077741|ref|XP_008439360.1| (PREDICTED: ethylene-responsive transcription factor ERF118-like [Cucumis melo]) HSP 1 Score: 122.9 bits (307), Expect = 3.8e-25 Identity = 68/103 (66.02%), Postives = 74/103 (71.84%), Query Frame = 1
BLAST of CmaCh06G012630 vs. NCBI nr
Match: gi|449433193|ref|XP_004134382.1| (PREDICTED: ethylene-responsive transcription factor ERF118-like [Cucumis sativus]) HSP 1 Score: 122.5 bits (306), Expect = 5.0e-25 Identity = 73/122 (59.84%), Postives = 83/122 (68.03%), Query Frame = 1
BLAST of CmaCh06G012630 vs. NCBI nr
Match: gi|700201629|gb|KGN56762.1| (hypothetical protein Csa_3G133130 [Cucumis sativus]) HSP 1 Score: 122.5 bits (306), Expect = 5.0e-25 Identity = 73/122 (59.84%), Postives = 83/122 (68.03%), Query Frame = 1
BLAST of CmaCh06G012630 vs. NCBI nr
Match: gi|659089721|ref|XP_008445662.1| (PREDICTED: ethylene-responsive transcription factor ERF118 [Cucumis melo]) HSP 1 Score: 121.3 bits (303), Expect = 1.1e-24 Identity = 72/112 (64.29%), Postives = 81/112 (72.32%), Query Frame = 1
BLAST of CmaCh06G012630 vs. NCBI nr
Match: gi|449446199|ref|XP_004140859.1| (PREDICTED: ethylene-responsive transcription factor ERF118 [Cucumis sativus]) HSP 1 Score: 120.9 bits (302), Expect = 1.4e-24 Identity = 68/99 (68.69%), Postives = 76/99 (76.77%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |