Cla97C05G084190 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTCGAAAAATCCGCGTAATCTGCAACGATCCAGATGGAACCGATTCATCTTCCAGCGAAAACGAAAGAGACGAAACAAAATCTTCAAAATCCAAACGCATAGTACGAGAAATTCACTTCCCCGTTTTCCCTTCTCACTCTTCCTCTCAATCAATCCATGATGAAACCTCTCAGAGCTCTTCTCACGACAGCAACAATGGTGGAAAAACCCAACAGCTAACGAGCATTAGGGTTTTAAGCAAAACCCTAACGACCGGAAGAACGCCCTGCCGATATAGAGGCGTGAGGCAGAGAAAATGGGGGAAATGGGCTGCTGAAATACGAGACCCCTTCAAAAGAGCTCGAATTTGGCTTGGAACTTACAATACTGCTGAGGAAGCTTCTAGGGCTTACGAATCGAAGCGGCTCGAGTTCCAATCTGCCATGGCCGCCGCCCCCAAAGCTCCACCGCGGTTCAAAGCTTCTCATCTACTGGGTTTCTGA ATGAGTCGAAAAATCCGCGTAATCTGCAACGATCCAGATGGAACCGATTCATCTTCCAGCGAAAACGAAAGAGACGAAACAAAATCTTCAAAATCCAAACGCATAGTACGAGAAATTCACTTCCCCGTTTTCCCTTCTCACTCTTCCTCTCAATCAATCCATGATGAAACCTCTCAGAGCTCTTCTCACGACAGCAACAATGGTGGAAAAACCCAACAGCTAACGAGCATTAGGGTTTTAAGCAAAACCCTAACGACCGGAAGAACGCCCTGCCGATATAGAGGCGTGAGGCAGAGAAAATGGGGGAAATGGGCTGCTGAAATACGAGACCCCTTCAAAAGAGCTCGAATTTGGCTTGGAACTTACAATACTGCTGAGGAAGCTTCTAGGGCTTACGAATCGAAGCGGCTCGAGTTCCAATCTGCCATGGCCGCCGCCCCCAAAGCTCCACCGCGGTTCAAAGCTTCTCATCTACTGGGTTTCTGA ATGAGTCGAAAAATCCGCGTAATCTGCAACGATCCAGATGGAACCGATTCATCTTCCAGCGAAAACGAAAGAGACGAAACAAAATCTTCAAAATCCAAACGCATAGTACGAGAAATTCACTTCCCCGTTTTCCCTTCTCACTCTTCCTCTCAATCAATCCATGATGAAACCTCTCAGAGCTCTTCTCACGACAGCAACAATGGTGGAAAAACCCAACAGCTAACGAGCATTAGGGTTTTAAGCAAAACCCTAACGACCGGAAGAACGCCCTGCCGATATAGAGGCGTGAGGCAGAGAAAATGGGGGAAATGGGCTGCTGAAATACGAGACCCCTTCAAAAGAGCTCGAATTTGGCTTGGAACTTACAATACTGCTGAGGAAGCTTCTAGGGCTTACGAATCGAAGCGGCTCGAGTTCCAATCTGCCATGGCCGCCGCCCCCAAAGCTCCACCGCGGTTCAAAGCTTCTCATCTACTGGGTTTCTGA MSRKIRVICNDPDGTDSSSSENERDETKSSKSKRIVREIHFPVFPSHSSSQSIHDETSQSSSHDSNNGGKTQQLTSIRVLSKTLTTGRTPCRYRGVRQRKWGKWAAEIRDPFKRARIWLGTYNTAEEASRAYESKRLEFQSAMAAAPKAPPRFKASHLLGF
BLAST of Cla97C05G084190 vs. NCBI nr
Match: XP_022924585.1 (ethylene-responsive transcription factor ERF118-like [Cucurbita moschata] >XP_023528036.1 ethylene-responsive transcription factor ERF118-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 185.3 bits (469), Expect = 1.7e-43 Identity = 147/161 (91.30%), Postives = 150/161 (93.17%), Query Frame = 0
BLAST of Cla97C05G084190 vs. NCBI nr
Match: XP_022980438.1 (ethylene-responsive transcription factor ERF118-like [Cucurbita maxima]) HSP 1 Score: 182.2 bits (461), Expect = 1.4e-42 Identity = 134/161 (83.23%), Postives = 137/161 (85.09%), Query Frame = 0
BLAST of Cla97C05G084190 vs. NCBI nr
Match: XP_004134382.1 (PREDICTED: ethylene-responsive transcription factor ERF118-like [Cucumis sativus]) HSP 1 Score: 166.4 bits (420), Expect = 8.0e-38 Identity = 133/164 (81.10%), Postives = 138/164 (84.15%), Query Frame = 0
BLAST of Cla97C05G084190 vs. NCBI nr
Match: XP_008439360.1 (PREDICTED: ethylene-responsive transcription factor ERF118-like [Cucumis melo]) HSP 1 Score: 166.4 bits (420), Expect = 8.0e-38 Identity = 131/164 (79.88%), Postives = 138/164 (84.15%), Query Frame = 0
BLAST of Cla97C05G084190 vs. NCBI nr
Match: KGN56762.1 (hypothetical protein Csa_3G133130 [Cucumis sativus]) HSP 1 Score: 166.4 bits (420), Expect = 8.0e-38 Identity = 134/164 (81.71%), Postives = 139/164 (84.76%), Query Frame = 0
BLAST of Cla97C05G084190 vs. TrEMBL
Match: tr|A0A1S3AYM8|A0A1S3AYM8_CUCME (ethylene-responsive transcription factor ERF118-like OS=Cucumis melo OX=3656 GN=LOC103484175 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 5.3e-38 Identity = 131/164 (79.88%), Postives = 138/164 (84.15%), Query Frame = 0
BLAST of Cla97C05G084190 vs. TrEMBL
Match: tr|A0A0A0L811|A0A0A0L811_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G133130 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 5.3e-38 Identity = 134/164 (81.71%), Postives = 139/164 (84.76%), Query Frame = 0
BLAST of Cla97C05G084190 vs. TrEMBL
Match: tr|A0A1S3BD92|A0A1S3BD92_CUCME (ethylene-responsive transcription factor ERF118 OS=Cucumis melo OX=3656 GN=LOC103488620 PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 3.0e-25 Identity = 73/145 (50.34%), Postives = 82/145 (56.55%), Query Frame = 0
BLAST of Cla97C05G084190 vs. TrEMBL
Match: tr|A0A0A0K880|A0A0A0K880_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G039270 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 4.8e-23 Identity = 78/144 (54.17%), Postives = 85/144 (59.03%), Query Frame = 0
BLAST of Cla97C05G084190 vs. TrEMBL
Match: tr|A0A2P4IMX7|A0A2P4IMX7_QUESU (Ethylene-responsive transcription factor OS=Quercus suber OX=58331 GN=CFP56_38095 PE=4 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 1.7e-20 Identity = 64/148 (43.24%), Postives = 74/148 (50.00%), Query Frame = 0
BLAST of Cla97C05G084190 vs. Swiss-Prot
Match: sp|Q9C5I3|ERF76_ARATH (Ethylene-responsive transcription factor 11 OS=Arabidopsis thaliana OX=3702 GN=ERF11 PE=2 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.1e-14 Identity = 34/53 (64.15%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of Cla97C05G084190 vs. Swiss-Prot
Match: sp|Q9FGF8|ABR1_ARATH (Ethylene-responsive transcription factor ABR1 OS=Arabidopsis thaliana OX=3702 GN=ABR1 PE=2 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.5e-14 Identity = 36/53 (67.92%), Postives = 42/53 (79.25%), Query Frame = 0
BLAST of Cla97C05G084190 vs. Swiss-Prot
Match: sp|Q9CA27|EF118_ARATH (Ethylene-responsive transcription factor ERF118 OS=Arabidopsis thaliana OX=3702 GN=ERF118 PE=2 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.9e-14 Identity = 34/50 (68.00%), Postives = 44/50 (88.00%), Query Frame = 0
BLAST of Cla97C05G084190 vs. Swiss-Prot
Match: sp|Q7G1L2|RAP26_ARATH (Ethylene-responsive transcription factor RAP2-6 OS=Arabidopsis thaliana OX=3702 GN=RAP2-6 PE=2 SV=2) HSP 1 Score: 80.1 bits (196), Expect = 2.5e-14 Identity = 35/55 (63.64%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of Cla97C05G084190 vs. Swiss-Prot
Match: sp|Q70II3|EF110_ARATH (Ethylene-responsive transcription factor ERF110 OS=Arabidopsis thaliana OX=3702 GN=ERF110 PE=2 SV=2) HSP 1 Score: 78.6 bits (192), Expect = 7.2e-14 Identity = 35/53 (66.04%), Postives = 42/53 (79.25%), Query Frame = 0
BLAST of Cla97C05G084190 vs. TAIR10
Match: AT1G28370.1 (ERF domain protein 11) HSP 1 Score: 81.3 bits (199), Expect = 6.2e-16 Identity = 34/53 (64.15%), Postives = 47/53 (88.68%), Query Frame = 0
BLAST of Cla97C05G084190 vs. TAIR10
Match: AT5G64750.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 80.9 bits (198), Expect = 8.0e-16 Identity = 36/53 (67.92%), Postives = 42/53 (79.25%), Query Frame = 0
BLAST of Cla97C05G084190 vs. TAIR10
Match: AT1G68550.1 (Integrase-type DNA-binding superfamily protein) HSP 1 Score: 80.5 bits (197), Expect = 1.1e-15 Identity = 34/50 (68.00%), Postives = 44/50 (88.00%), Query Frame = 0
BLAST of Cla97C05G084190 vs. TAIR10
Match: AT1G43160.1 (related to AP2 6) HSP 1 Score: 80.1 bits (196), Expect = 1.4e-15 Identity = 35/55 (63.64%), Postives = 43/55 (78.18%), Query Frame = 0
BLAST of Cla97C05G084190 vs. TAIR10
Match: AT5G50080.1 (ethylene response factor 110) HSP 1 Score: 78.6 bits (192), Expect = 4.0e-15 Identity = 35/53 (66.04%), Postives = 42/53 (79.25%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |