Cla97C07G137210 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGCAACTCACTCAACTAGGGTTGTGATTATTGACACCAAGTATGTACAAACGGATGCCAAGAGCTTCAAGACGGTGGTGCAAAAGCTGACGGGGAAAGATCCGGTAGTCGCAGTGGCGGAGGAGAACCGACATACCCGCAGCGCCCGGAACTCGGGTCTTTTGAGAGATTCATCGTTCAAGGAGTTCCAGAGAGTGCTGAGAGAGATGCCAAGAATTGATGAGCTTTATTCTGATTGA ATGGAAGCAACTCACTCAACTAGGGTTGTGATTATTGACACCAAGTATGTACAAACGGATGCCAAGAGCTTCAAGACGGTGGTGCAAAAGCTGACGGGGAAAGATCCGGTAGTCGCAGTGGCGGAGGAGAACCGACATACCCGCAGCGCCCGGAACTCGGGTCTTTTGAGAGATTCATCGTTCAAGGAGTTCCAGAGAGTGCTGAGAGAGATGCCAAGAATTGATGAGCTTTATTCTGATTGA ATGGAAGCAACTCACTCAACTAGGGTTGTGATTATTGACACCAAGTATGTACAAACGGATGCCAAGAGCTTCAAGACGGTGGTGCAAAAGCTGACGGGGAAAGATCCGGTAGTCGCAGTGGCGGAGGAGAACCGACATACCCGCAGCGCCCGGAACTCGGGTCTTTTGAGAGATTCATCGTTCAAGGAGTTCCAGAGAGTGCTGAGAGAGATGCCAAGAATTGATGAGCTTTATTCTGATTGA MEATHSTRVVIIDTKYVQTDAKSFKTVVQKLTGKDPVVAVAEENRHTRSARNSGLLRDSSFKEFQRVLREMPRIDELYSD
BLAST of Cla97C07G137210 vs. NCBI nr
Match: KGN53544.1 (hypothetical protein Csa_4G075740 [Cucumis sativus]) HSP 1 Score: 133.3 bits (334), Expect = 3.7e-28 Identity = 73/81 (90.12%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of Cla97C07G137210 vs. NCBI nr
Match: XP_022942030.1 (VQ motif-containing protein 1 [Cucurbita moschata]) HSP 1 Score: 92.4 bits (228), Expect = 7.3e-16 Identity = 53/71 (74.65%), Postives = 56/71 (78.87%), Query Frame = 0
BLAST of Cla97C07G137210 vs. NCBI nr
Match: XP_023543644.1 (VQ motif-containing protein 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 87.8 bits (216), Expect = 1.8e-14 Identity = 51/71 (71.83%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of Cla97C07G137210 vs. NCBI nr
Match: XP_017423422.1 (PREDICTED: VQ motif-containing protein 1-like [Vigna angularis] >KOM42707.1 hypothetical protein LR48_Vigan05g031100 [Vigna angularis] >BAT93164.1 hypothetical protein VIGAN_07207900 [Vigna angularis var. angularis]) HSP 1 Score: 77.8 bits (190), Expect = 1.9e-11 Identity = 43/76 (56.58%), Postives = 58/76 (76.32%), Query Frame = 0
BLAST of Cla97C07G137210 vs. NCBI nr
Match: XP_022636061.1 (VQ motif-containing protein 1 [Vigna radiata var. radiata]) HSP 1 Score: 77.0 bits (188), Expect = 3.2e-11 Identity = 44/73 (60.27%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of Cla97C07G137210 vs. TrEMBL
Match: tr|A0A0A0KXJ0|A0A0A0KXJ0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G075740 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 2.5e-28 Identity = 73/81 (90.12%), Postives = 73/81 (90.12%), Query Frame = 0
BLAST of Cla97C07G137210 vs. TrEMBL
Match: tr|A0A0L9UJH2|A0A0L9UJH2_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan05g031100 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.2e-11 Identity = 43/76 (56.58%), Postives = 58/76 (76.32%), Query Frame = 0
BLAST of Cla97C07G137210 vs. TrEMBL
Match: tr|A0A0S3SJY7|A0A0S3SJY7_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.07G207900 PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 1.2e-11 Identity = 43/76 (56.58%), Postives = 58/76 (76.32%), Query Frame = 0
BLAST of Cla97C07G137210 vs. TrEMBL
Match: tr|A0A1S3U0D9|A0A1S3U0D9_VIGRR (VQ motif-containing protein 1-like OS=Vigna radiata var. radiata OX=3916 GN=LOC106760578 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 2.1e-11 Identity = 44/73 (60.27%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of Cla97C07G137210 vs. TrEMBL
Match: tr|A0A022RDS2|A0A022RDS2_ERYGU (Uncharacterized protein OS=Erythranthe guttata OX=4155 GN=MIMGU_mgv1a023640mg PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 6.1e-11 Identity = 38/71 (53.52%), Postives = 53/71 (74.65%), Query Frame = 0
BLAST of Cla97C07G137210 vs. Swiss-Prot
Match: sp|Q8VYI5|VQ10_ARATH (VQ motif-containing protein 10 OS=Arabidopsis thaliana OX=3702 GN=VQ10 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.2e-06 Identity = 33/91 (36.26%), Postives = 49/91 (53.85%), Query Frame = 0
BLAST of Cla97C07G137210 vs. Swiss-Prot
Match: sp|Q1G3U8|VQ1_ARATH (VQ motif-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=VQ1 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.2e-06 Identity = 37/87 (42.53%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of Cla97C07G137210 vs. TAIR10
Match: AT1G78410.1 (VQ motif-containing protein) HSP 1 Score: 53.5 bits (127), Expect = 6.8e-08 Identity = 33/91 (36.26%), Postives = 49/91 (53.85%), Query Frame = 0
BLAST of Cla97C07G137210 vs. TAIR10
Match: AT1G17147.1 (VQ motif-containing protein) HSP 1 Score: 53.5 bits (127), Expect = 6.8e-08 Identity = 37/87 (42.53%), Postives = 51/87 (58.62%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|