Carg11382 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGCTTATTCGACTCGGGTTGTGATCATCGACACCAAGTATGTGCAAACGGATGCCAAGAGCTTCAAGACGGTGGTGCAGAAGCTGACGGGGAAGGACCCGGTGGCGGAGGAGAATCGACATGGTGACGGTGCCCGGAACTCGAGTCTTTTGAGAGATTCGTCGTTCAAGGAGTTCCAAAGAGTGCTGCGAGAGATGCCAAGAATTGATTAG ATGGCAGCTTATTCGACTCGGGTTGTGATCATCGACACCAAGTATGTGCAAACGGATGCCAAGAGCTTCAAGACGGTGGTGCAGAAGCTGACGGGGAAGGACCCGGTGGCGGAGGAGAATCGACATGGTGACGGTGCCCGGAACTCGAGTCTTTTGAGAGATTCGTCGTTCAAGGAGTTCCAAAGAGTGCTGCGAGAGATGCCAAGAATTGATTAG ATGGCAGCTTATTCGACTCGGGTTGTGATCATCGACACCAAGTATGTGCAAACGGATGCCAAGAGCTTCAAGACGGTGGTGCAGAAGCTGACGGGGAAGGACCCGGTGGCGGAGGAGAATCGACATGGTGACGGTGCCCGGAACTCGAGTCTTTTGAGAGATTCGTCGTTCAAGGAGTTCCAAAGAGTGCTGCGAGAGATGCCAAGAATTGATTAG MAAYSTRVVIIDTKYVQTDAKSFKTVVQKLTGKDPVAEENRHGDGARNSSLLRDSSFKEFQRVLREMPRID
BLAST of Carg11382 vs. NCBI nr
Match: KGN53544.1 (hypothetical protein Csa_4G075740 [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 6.7e-21 Identity = 63/74 (85.14%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of Carg11382 vs. NCBI nr
Match: XP_022942030.1 (VQ motif-containing protein 1 [Cucurbita moschata]) HSP 1 Score: 93.6 bits (231), Expect = 2.9e-16 Identity = 51/69 (73.91%), Postives = 55/69 (79.71%), Query Frame = 0
BLAST of Carg11382 vs. NCBI nr
Match: XP_023543644.1 (VQ motif-containing protein 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 91.7 bits (226), Expect = 1.1e-15 Identity = 50/69 (72.46%), Postives = 56/69 (81.16%), Query Frame = 0
BLAST of Carg11382 vs. NCBI nr
Match: XP_017423422.1 (PREDICTED: VQ motif-containing protein 1-like [Vigna angularis] >KOM42707.1 hypothetical protein LR48_Vigan05g031100 [Vigna angularis] >BAT93164.1 hypothetical protein VIGAN_07207900 [Vigna angularis var. angularis]) HSP 1 Score: 78.2 bits (191), Expect = 1.3e-11 Identity = 44/71 (61.97%), Postives = 53/71 (74.65%), Query Frame = 0
BLAST of Carg11382 vs. NCBI nr
Match: XP_017423423.1 (PREDICTED: VQ motif-containing protein 1-like [Vigna angularis]) HSP 1 Score: 76.3 bits (186), Expect = 4.8e-11 Identity = 43/71 (60.56%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of Carg11382 vs. TAIR10
Match: AT1G17147.1 (VQ motif-containing protein) HSP 1 Score: 49.7 bits (117), Expect = 8.8e-07 Identity = 33/78 (42.31%), Postives = 44/78 (56.41%), Query Frame = 0
BLAST of Carg11382 vs. TAIR10
Match: AT1G78410.1 (VQ motif-containing protein) HSP 1 Score: 45.8 bits (107), Expect = 1.3e-05 Identity = 33/89 (37.08%), Postives = 48/89 (53.93%), Query Frame = 0
BLAST of Carg11382 vs. Swiss-Prot
Match: sp|Q1G3U8|VQ1_ARATH (VQ motif-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=VQ1 PE=1 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.6e-05 Identity = 33/78 (42.31%), Postives = 44/78 (56.41%), Query Frame = 0
BLAST of Carg11382 vs. Swiss-Prot
Match: sp|Q8VYI5|VQ10_ARATH (VQ motif-containing protein 10 OS=Arabidopsis thaliana OX=3702 GN=VQ10 PE=1 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 2.3e-04 Identity = 33/89 (37.08%), Postives = 48/89 (53.93%), Query Frame = 0
BLAST of Carg11382 vs. TrEMBL
Match: tr|A0A0A0KXJ0|A0A0A0KXJ0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G075740 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 4.4e-21 Identity = 63/74 (85.14%), Postives = 64/74 (86.49%), Query Frame = 0
BLAST of Carg11382 vs. TrEMBL
Match: tr|A0A0L9UJH2|A0A0L9UJH2_PHAAN (Uncharacterized protein OS=Phaseolus angularis OX=3914 GN=LR48_Vigan05g031100 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 8.4e-12 Identity = 44/71 (61.97%), Postives = 53/71 (74.65%), Query Frame = 0
BLAST of Carg11382 vs. TrEMBL
Match: tr|A0A0S3SJY7|A0A0S3SJY7_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis OX=157739 GN=Vigan.07G207900 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 8.4e-12 Identity = 44/71 (61.97%), Postives = 53/71 (74.65%), Query Frame = 0
BLAST of Carg11382 vs. TrEMBL
Match: tr|A0A1S3U0D9|A0A1S3U0D9_VIGRR (VQ motif-containing protein 1-like OS=Vigna radiata var. radiata OX=3916 GN=LOC106760578 PE=4 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 5.4e-11 Identity = 43/71 (60.56%), Postives = 52/71 (73.24%), Query Frame = 0
BLAST of Carg11382 vs. TrEMBL
Match: tr|V7BXC0|V7BXC0_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris OX=3885 GN=PHAVU_005G051400g PE=4 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 2.1e-10 Identity = 41/71 (57.75%), Postives = 51/71 (71.83%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|