Cla97C05G091740 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACAAACAGAAGGTGATTGTAACTGGATATGTAGAGGAAAGAAAAGTGTTGAAGGTGGTGAGAGGAACAGGGCGAAAAGCTGAGCTATGGCCGTTCCCTTACGACAACGAATACTACCCGTACGCATCACAATACTACGACGAATCAACATATGCATCAACATATAATTATTATAGGCATGGTTTCAATGAAGGCGTCCATGGATACTTTCCAGATCCTTTATATTCAACTGTTAGCGATAACACTGTTCATCTTTTTAGTGAAGATAATGTCCATGCTTATTGTAGTGTTATGTGA ATGGACAAACAGAAGGTGATTGTAACTGGATATGTAGAGGAAAGAAAAGTGTTGAAGGTGGTGAGAGGAACAGGGCGAAAAGCTGAGCTATGGCCGTTCCCTTACGACAACGAATACTACCCGTACGCATCACAATACTACGACGAATCAACATATGCATCAACATATAATTATTATAGGCATGGTTTCAATGAAGGCGTCCATGGATACTTTCCAGATCCTTTATATTCAACTGTTAGCGATAACACTGTTCATCTTTTTAGTGAAGATAATGTCCATGCTTATTGTAGTGTTATGTGA ATGGACAAACAGAAGGTGATTGTAACTGGATATGTAGAGGAAAGAAAAGTGTTGAAGGTGGTGAGAGGAACAGGGCGAAAAGCTGAGCTATGGCCGTTCCCTTACGACAACGAATACTACCCGTACGCATCACAATACTACGACGAATCAACATATGCATCAACATATAATTATTATAGGCATGGTTTCAATGAAGGCGTCCATGGATACTTTCCAGATCCTTTATATTCAACTGTTAGCGATAACACTGTTCATCTTTTTAGTGAAGATAATGTCCATGCTTATTGTAGTGTTATGTGA MDKQKVIVTGYVEERKVLKVVRGTGRKAELWPFPYDNEYYPYASQYYDESTYASTYNYYRHGFNEGVHGYFPDPLYSTVSDNTVHLFSEDNVHAYCSVM
BLAST of Cla97C05G091740 vs. NCBI nr
Match: XP_008456034.1 (PREDICTED: heavy metal-associated isoprenylated plant protein 21 [Cucumis melo]) HSP 1 Score: 132.9 bits (333), Expect = 6.1e-28 Identity = 96/99 (96.97%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of Cla97C05G091740 vs. NCBI nr
Match: XP_022136878.1 (heavy metal-associated isoprenylated plant protein 45 [Momordica charantia]) HSP 1 Score: 130.6 bits (327), Expect = 3.0e-27 Identity = 65/99 (65.66%), Postives = 66/99 (66.67%), Query Frame = 0
BLAST of Cla97C05G091740 vs. NCBI nr
Match: XP_004146252.1 (PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Cucumis sativus] >KGN57619.1 hypothetical protein Csa_3G231930 [Cucumis sativus]) HSP 1 Score: 129.8 bits (325), Expect = 5.1e-27 Identity = 92/99 (92.93%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of Cla97C05G091740 vs. NCBI nr
Match: XP_022923013.1 (heavy metal-associated isoprenylated plant protein 45-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 127.9 bits (320), Expect = 1.9e-26 Identity = 95/99 (95.96%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of Cla97C05G091740 vs. NCBI nr
Match: XP_022984156.1 (heavy metal-associated isoprenylated plant protein 45-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 127.9 bits (320), Expect = 1.9e-26 Identity = 95/99 (95.96%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of Cla97C05G091740 vs. TrEMBL
Match: tr|A0A1S3C2Z5|A0A1S3C2Z5_CUCME (heavy metal-associated isoprenylated plant protein 21 OS=Cucumis melo OX=3656 GN=LOC103496085 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 4.0e-28 Identity = 96/99 (96.97%), Postives = 98/99 (98.99%), Query Frame = 0
BLAST of Cla97C05G091740 vs. TrEMBL
Match: tr|A0A0A0L9G7|A0A0A0L9G7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G231930 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 3.4e-27 Identity = 92/99 (92.93%), Postives = 96/99 (96.97%), Query Frame = 0
BLAST of Cla97C05G091740 vs. TrEMBL
Match: tr|A0A251N5M4|A0A251N5M4_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_7G025000 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 6.0e-24 Identity = 58/99 (58.59%), Postives = 64/99 (64.65%), Query Frame = 0
BLAST of Cla97C05G091740 vs. TrEMBL
Match: tr|M5VSE8|M5VSE8_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_ppa013392mg PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 6.0e-24 Identity = 58/99 (58.59%), Postives = 64/99 (64.65%), Query Frame = 0
BLAST of Cla97C05G091740 vs. TrEMBL
Match: tr|A0A2P6RH70|A0A2P6RH70_ROSCH (Putative heavy metal-associated domain, HMA OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr3g0495281 PE=4 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 7.8e-24 Identity = 89/99 (89.90%), Postives = 94/99 (94.95%), Query Frame = 0
BLAST of Cla97C05G091740 vs. Swiss-Prot
Match: sp|B3H6D0|HIP45_ARATH (Heavy metal-associated isoprenylated plant protein 45 OS=Arabidopsis thaliana OX=3702 GN=HIPP45 PE=3 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.1e-09 Identity = 38/118 (32.20%), Postives = 52/118 (44.07%), Query Frame = 0
BLAST of Cla97C05G091740 vs. Swiss-Prot
Match: sp|F4IC29|HIP28_ARATH (Heavy metal-associated isoprenylated plant protein 28 OS=Arabidopsis thaliana OX=3702 GN=HIPP28 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.6e-06 Identity = 23/39 (58.97%), Postives = 31/39 (79.49%), Query Frame = 0
BLAST of Cla97C05G091740 vs. Swiss-Prot
Match: sp|Q9LF57|HIP21_ARATH (Heavy metal-associated isoprenylated plant protein 21 OS=Arabidopsis thaliana OX=3702 GN=HIPP21 PE=1 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 2.2e-05 Identity = 31/98 (31.63%), Postives = 43/98 (43.88%), Query Frame = 0
BLAST of Cla97C05G091740 vs. Swiss-Prot
Match: sp|F4IQG4|HIP30_ARATH (Heavy metal-associated isoprenylated plant protein 30 OS=Arabidopsis thaliana OX=3702 GN=HIPP30 PE=1 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.4e-04 Identity = 18/34 (52.94%), Postives = 26/34 (76.47%), Query Frame = 0
BLAST of Cla97C05G091740 vs. Swiss-Prot
Match: sp|Q84K70|HIP31_ARATH (Heavy metal-associated isoprenylated plant protein 31 OS=Arabidopsis thaliana OX=3702 GN=HIPP31 PE=2 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.4e-04 Identity = 32/104 (30.77%), Postives = 46/104 (44.23%), Query Frame = 0
BLAST of Cla97C05G091740 vs. TAIR10
Match: AT3G56891.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 63.9 bits (154), Expect = 6.3e-11 Identity = 38/118 (32.20%), Postives = 52/118 (44.07%), Query Frame = 0
BLAST of Cla97C05G091740 vs. TAIR10
Match: AT1G06330.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 52.8 bits (125), Expect = 1.4e-07 Identity = 23/39 (58.97%), Postives = 31/39 (79.49%), Query Frame = 0
BLAST of Cla97C05G091740 vs. TAIR10
Match: AT5G17450.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 49.7 bits (117), Expect = 1.2e-06 Identity = 31/98 (31.63%), Postives = 43/98 (43.88%), Query Frame = 0
BLAST of Cla97C05G091740 vs. TAIR10
Match: AT2G18196.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 47.0 bits (110), Expect = 7.9e-06 Identity = 18/34 (52.94%), Postives = 26/34 (76.47%), Query Frame = 0
BLAST of Cla97C05G091740 vs. TAIR10
Match: AT3G48970.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 47.0 bits (110), Expect = 7.9e-06 Identity = 32/104 (30.77%), Postives = 46/104 (44.23%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|