Cla004301 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACAAACAGAAGGTGATTGTAACTGGATATGTAGAGGAAAGAAAAGTGTTGAAGGTGGTGAGAGGAACAGGGCGAAAAGCTGAGCTATGGCCGTTCCCTTACGACAACGAATACTACCCGTACGCATCACAATACTACGACGAATCAACATATGCATCAACATATAATTATTATAGGCATGGTTTCAATGAAGGCGTCCATGGATACTTTCCAGATCCTTTATATTCAACTGTTAGCGATAACACTGTTCATCTTTTTAGTGAAGATAATGTCCATGCTTATTGTAGTGTTATGTGA ATGGACAAACAGAAGGTGATTGTAACTGGATATGTAGAGGAAAGAAAAGTGTTGAAGGTGGTGAGAGGAACAGGGCGAAAAGCTGAGCTATGGCCGTTCCCTTACGACAACGAATACTACCCGTACGCATCACAATACTACGACGAATCAACATATGCATCAACATATAATTATTATAGGCATGGTTTCAATGAAGGCGTCCATGGATACTTTCCAGATCCTTTATATTCAACTGTTAGCGATAACACTGTTCATCTTTTTAGTGAAGATAATGTCCATGCTTATTGTAGTGTTATGTGA ATGGACAAACAGAAGGTGATTGTAACTGGATATGTAGAGGAAAGAAAAGTGTTGAAGGTGGTGAGAGGAACAGGGCGAAAAGCTGAGCTATGGCCGTTCCCTTACGACAACGAATACTACCCGTACGCATCACAATACTACGACGAATCAACATATGCATCAACATATAATTATTATAGGCATGGTTTCAATGAAGGCGTCCATGGATACTTTCCAGATCCTTTATATTCAACTGTTAGCGATAACACTGTTCATCTTTTTAGTGAAGATAATGTCCATGCTTATTGTAGTGTTATGTGA MDKQKVIVTGYVEERKVLKVVRGTGRKAELWPFPYDNEYYPYASQYYDESTYASTYNYYRHGFNEGVHGYFPDPLYSTVSDNTVHLFSEDNVHAYCSVM
BLAST of Cla004301 vs. Swiss-Prot
Match: HIP21_ARATH (Heavy metal-associated isoprenylated plant protein 21 OS=Arabidopsis thaliana GN=HIPP21 PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.0e-11 Identity = 38/98 (38.78%), Postives = 50/98 (51.02%), Query Frame = 1
BLAST of Cla004301 vs. Swiss-Prot
Match: HIP20_ARATH (Heavy metal-associated isoprenylated plant protein 20 OS=Arabidopsis thaliana GN=HIPP20 PE=2 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 3.6e-08 Identity = 38/96 (39.58%), Postives = 52/96 (54.17%), Query Frame = 1
BLAST of Cla004301 vs. Swiss-Prot
Match: HIP22_ARATH (Heavy metal-associated isoprenylated plant protein 22 OS=Arabidopsis thaliana GN=HIPP22 PE=2 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.3e-07 Identity = 39/97 (40.21%), Postives = 51/97 (52.58%), Query Frame = 1
BLAST of Cla004301 vs. Swiss-Prot
Match: HIP25_ARATH (Heavy metal-associated isoprenylated plant protein 25 OS=Arabidopsis thaliana GN=HIPP25 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 9.7e-06 Identity = 26/47 (55.32%), Postives = 32/47 (68.09%), Query Frame = 1
BLAST of Cla004301 vs. TrEMBL
Match: A0A0A0L9G7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G231930 PE=4 SV=1) HSP 1 Score: 208.8 bits (530), Expect = 3.1e-51 Identity = 94/99 (94.95%), Postives = 98/99 (98.99%), Query Frame = 1
BLAST of Cla004301 vs. TrEMBL
Match: A0A061EYX8_THECC (Heavy metal transport/detoxification superfamily protein isoform 2 OS=Theobroma cacao GN=TCM_025236 PE=4 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 1.7e-44 Identity = 83/99 (83.84%), Postives = 91/99 (91.92%), Query Frame = 1
BLAST of Cla004301 vs. TrEMBL
Match: A0A061EZK6_THECC (Heavy metal transport/detoxification superfamily protein isoform 1 OS=Theobroma cacao GN=TCM_025236 PE=4 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 1.7e-44 Identity = 83/99 (83.84%), Postives = 91/99 (91.92%), Query Frame = 1
BLAST of Cla004301 vs. TrEMBL
Match: W9SW68_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_027991 PE=4 SV=1) HSP 1 Score: 186.0 bits (471), Expect = 2.2e-44 Identity = 82/99 (82.83%), Postives = 90/99 (90.91%), Query Frame = 1
BLAST of Cla004301 vs. TrEMBL
Match: M5VSE8_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa013392mg PE=4 SV=1) HSP 1 Score: 184.5 bits (467), Expect = 6.3e-44 Identity = 82/99 (82.83%), Postives = 90/99 (90.91%), Query Frame = 1
BLAST of Cla004301 vs. NCBI nr
Match: gi|659112036|ref|XP_008456034.1| (PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Cucumis melo]) HSP 1 Score: 211.8 bits (538), Expect = 5.3e-52 Identity = 96/99 (96.97%), Postives = 98/99 (98.99%), Query Frame = 1
BLAST of Cla004301 vs. NCBI nr
Match: gi|449457031|ref|XP_004146252.1| (PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Cucumis sativus]) HSP 1 Score: 208.8 bits (530), Expect = 4.5e-51 Identity = 94/99 (94.95%), Postives = 98/99 (98.99%), Query Frame = 1
BLAST of Cla004301 vs. NCBI nr
Match: gi|645270862|ref|XP_008240650.1| (PREDICTED: copper transport protein ATX1 [Prunus mume]) HSP 1 Score: 188.7 bits (478), Expect = 4.8e-45 Identity = 84/99 (84.85%), Postives = 91/99 (91.92%), Query Frame = 1
BLAST of Cla004301 vs. NCBI nr
Match: gi|590638344|ref|XP_007029366.1| (Heavy metal transport/detoxification superfamily protein isoform 2 [Theobroma cacao]) HSP 1 Score: 186.4 bits (472), Expect = 2.4e-44 Identity = 83/99 (83.84%), Postives = 91/99 (91.92%), Query Frame = 1
BLAST of Cla004301 vs. NCBI nr
Match: gi|657951383|ref|XP_008352454.1| (PREDICTED: copper transport protein ATX1 [Malus domestica]) HSP 1 Score: 186.4 bits (472), Expect = 2.4e-44 Identity = 81/99 (81.82%), Postives = 93/99 (93.94%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|