Carg11326 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACAAACAGAAGGTGACTGTAACTGGATATGTAGAAGAAAGAAAAGTACTAAAGAAGGTGAGAGGAACGGGGCGAAAAGCCGAGCTATGGCCGTTCCCTTACGACAGTGAATACTATCCATACGCGTCGCAATACTACGACGAATCGACTTATGCGTCGACGTATAACTATTACAGGCATGGTTTTAATGAAGGCGTCCATGGATACTTCCCAGATCCTTTATATTCAACTGTTAGTGATAACACTGTTCATCTTTTTAGTGAAGATAATGTCCATGCTTATTGTAGTGTTATGTGA ATGGACAAACAGAAGGTGACTGTAACTGGATATGTAGAAGAAAGAAAAGTACTAAAGAAGGTGAGAGGAACGGGGCGAAAAGCCGAGCTATGGCCGTTCCCTTACGACAGTGAATACTATCCATACGCGTCGCAATACTACGACGAATCGACTTATGCGTCGACGTATAACTATTACAGGCATGGTTTTAATGAAGGCGTCCATGGATACTTCCCAGATCCTTTATATTCAACTGTTAGTGATAACACTGTTCATCTTTTTAGTGAAGATAATGTCCATGCTTATTGTAGTGTTATGTGA ATGGACAAACAGAAGGTGACTGTAACTGGATATGTAGAAGAAAGAAAAGTACTAAAGAAGGTGAGAGGAACGGGGCGAAAAGCCGAGCTATGGCCGTTCCCTTACGACAGTGAATACTATCCATACGCGTCGCAATACTACGACGAATCGACTTATGCGTCGACGTATAACTATTACAGGCATGGTTTTAATGAAGGCGTCCATGGATACTTCCCAGATCCTTTATATTCAACTGTTAGTGATAACACTGTTCATCTTTTTAGTGAAGATAATGTCCATGCTTATTGTAGTGTTATGTGA MDKQKVTVTGYVEERKVLKKVRGTGRKAELWPFPYDSEYYPYASQYYDESTYASTYNYYRHGFNEGVHGYFPDPLYSTVSDNTVHLFSEDNVHAYCSVM
BLAST of Carg11326 vs. NCBI nr
Match: XP_022923013.1 (heavy metal-associated isoprenylated plant protein 45-like isoform X1 [Cucurbita moschata]) HSP 1 Score: 133.7 bits (335), Expect = 3.5e-28 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 0
BLAST of Carg11326 vs. NCBI nr
Match: XP_022984156.1 (heavy metal-associated isoprenylated plant protein 45-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 133.7 bits (335), Expect = 3.5e-28 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 0
BLAST of Carg11326 vs. NCBI nr
Match: XP_023553214.1 (heavy metal-associated isoprenylated plant protein 45-like [Cucurbita pepo subsp. pepo] >XP_023553216.1 heavy metal-associated isoprenylated plant protein 45-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 133.7 bits (335), Expect = 3.5e-28 Identity = 99/99 (100.00%), Postives = 99/99 (100.00%), Query Frame = 0
BLAST of Carg11326 vs. NCBI nr
Match: XP_004146252.1 (PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Cucumis sativus] >KGN57619.1 hypothetical protein Csa_3G231930 [Cucumis sativus]) HSP 1 Score: 127.5 bits (319), Expect = 2.5e-26 Identity = 92/99 (92.93%), Postives = 94/99 (94.95%), Query Frame = 0
BLAST of Carg11326 vs. NCBI nr
Match: XP_008456034.1 (PREDICTED: heavy metal-associated isoprenylated plant protein 21 [Cucumis melo]) HSP 1 Score: 127.5 bits (319), Expect = 2.5e-26 Identity = 94/99 (94.95%), Postives = 97/99 (97.98%), Query Frame = 0
BLAST of Carg11326 vs. TAIR10
Match: AT3G56891.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 62.0 bits (149), Expect = 2.4e-10 Identity = 38/118 (32.20%), Postives = 51/118 (43.22%), Query Frame = 0
BLAST of Carg11326 vs. TAIR10
Match: AT1G06330.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 57.8 bits (138), Expect = 4.5e-09 Identity = 25/39 (64.10%), Postives = 33/39 (84.62%), Query Frame = 0
BLAST of Carg11326 vs. TAIR10
Match: AT5G17450.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 53.9 bits (128), Expect = 6.5e-08 Identity = 32/98 (32.65%), Postives = 45/98 (45.92%), Query Frame = 0
BLAST of Carg11326 vs. TAIR10
Match: AT1G71050.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 48.9 bits (115), Expect = 2.1e-06 Identity = 21/33 (63.64%), Postives = 29/33 (87.88%), Query Frame = 0
BLAST of Carg11326 vs. TAIR10
Match: AT2G18196.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 48.5 bits (114), Expect = 2.7e-06 Identity = 19/34 (55.88%), Postives = 27/34 (79.41%), Query Frame = 0
BLAST of Carg11326 vs. Swiss-Prot
Match: sp|B3H6D0|HIP45_ARATH (Heavy metal-associated isoprenylated plant protein 45 OS=Arabidopsis thaliana OX=3702 GN=HIPP45 PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.3e-09 Identity = 38/118 (32.20%), Postives = 51/118 (43.22%), Query Frame = 0
BLAST of Carg11326 vs. Swiss-Prot
Match: sp|F4IC29|HIP28_ARATH (Heavy metal-associated isoprenylated plant protein 28 OS=Arabidopsis thaliana OX=3702 GN=HIPP28 PE=3 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 8.1e-08 Identity = 25/39 (64.10%), Postives = 33/39 (84.62%), Query Frame = 0
BLAST of Carg11326 vs. Swiss-Prot
Match: sp|Q9LF57|HIP21_ARATH (Heavy metal-associated isoprenylated plant protein 21 OS=Arabidopsis thaliana OX=3702 GN=HIPP21 PE=1 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.2e-06 Identity = 32/98 (32.65%), Postives = 45/98 (45.92%), Query Frame = 0
BLAST of Carg11326 vs. Swiss-Prot
Match: sp|Q9C9A3|HIP20_ARATH (Heavy metal-associated isoprenylated plant protein 20 OS=Arabidopsis thaliana OX=3702 GN=HIPP20 PE=1 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 3.8e-05 Identity = 21/33 (63.64%), Postives = 29/33 (87.88%), Query Frame = 0
BLAST of Carg11326 vs. Swiss-Prot
Match: sp|O65657|HIP23_ARATH (Heavy metal-associated isoprenylated plant protein 23 OS=Arabidopsis thaliana OX=3702 GN=HIPP23 PE=1 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 4.9e-05 Identity = 21/35 (60.00%), Postives = 29/35 (82.86%), Query Frame = 0
BLAST of Carg11326 vs. TrEMBL
Match: tr|A0A1S3C2Z5|A0A1S3C2Z5_CUCME (heavy metal-associated isoprenylated plant protein 21 OS=Cucumis melo OX=3656 GN=LOC103496085 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 1.7e-26 Identity = 94/99 (94.95%), Postives = 97/99 (97.98%), Query Frame = 0
BLAST of Carg11326 vs. TrEMBL
Match: tr|A0A0A0L9G7|A0A0A0L9G7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G231930 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 1.7e-26 Identity = 92/99 (92.93%), Postives = 94/99 (94.95%), Query Frame = 0
BLAST of Carg11326 vs. TrEMBL
Match: tr|A0A2P6RH70|A0A2P6RH70_ROSCH (Putative heavy metal-associated domain, HMA OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr3g0495281 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 4.6e-24 Identity = 91/99 (91.92%), Postives = 95/99 (95.96%), Query Frame = 0
BLAST of Carg11326 vs. TrEMBL
Match: tr|A0A251N5M4|A0A251N5M4_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_7G025000 PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 5.1e-23 Identity = 57/99 (57.58%), Postives = 64/99 (64.65%), Query Frame = 0
BLAST of Carg11326 vs. TrEMBL
Match: tr|M5VSE8|M5VSE8_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_ppa013392mg PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 5.1e-23 Identity = 57/99 (57.58%), Postives = 64/99 (64.65%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|