Carg23731 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGAGGTCTTCAAGTTGATCGACGAGGACGGAGACGGACGGTTGAGTGTCGCCGATTTGAAGAGCTACATGCATTTCGACGGATTTTCGATCTCCGATGAGGAGGTTGTAGCGATGATTCGATTCGATGGCGGAGATGAATCGGACGGCGTAACTTATGACGGTTTGCTGAAGATTTTGGCTGTTGATAAGTTCTATTAG ATGGAGGAGGTCTTCAAGTTGATCGACGAGGACGGAGACGGACGGTTGAGTGTCGCCGATTTGAAGAGCTACATGCATTTCGACGGATTTTCGATCTCCGATGAGGAGGTTGTAGCGATGATTCGATTCGATGGCGGAGATGAATCGGACGGCGTAACTTATGACGGTTTGCTGAAGATTTTGGCTGTTGATAAGTTCTATTAG ATGGAGGAGGTCTTCAAGTTGATCGACGAGGACGGAGACGGACGGTTGAGTGTCGCCGATTTGAAGAGCTACATGCATTTCGACGGATTTTCGATCTCCGATGAGGAGGTTGTAGCGATGATTCGATTCGATGGCGGAGATGAATCGGACGGCGTAACTTATGACGGTTTGCTGAAGATTTTGGCTGTTGATAAGTTCTATTAG MEEVFKLIDEDGDGRLSVADLKSYMHFDGFSISDEEVVAMIRFDGGDESDGVTYDGLLKILAVDKFY
BLAST of Carg23731 vs. NCBI nr
Match: XP_022955465.1 (calmodulin-beta-like [Cucurbita moschata]) HSP 1 Score: 112.8 bits (281), Expect = 4.4e-22 Identity = 55/67 (82.09%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of Carg23731 vs. NCBI nr
Match: XP_022979972.1 (calmodulin-A-like [Cucurbita maxima]) HSP 1 Score: 112.8 bits (281), Expect = 4.4e-22 Identity = 55/67 (82.09%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of Carg23731 vs. NCBI nr
Match: XP_008438964.1 (PREDICTED: calmodulin [Cucumis melo]) HSP 1 Score: 111.7 bits (278), Expect = 9.8e-22 Identity = 54/67 (80.60%), Postives = 58/67 (86.57%), Query Frame = 0
BLAST of Carg23731 vs. NCBI nr
Match: XP_023526324.1 (calmodulin-beta-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 111.7 bits (278), Expect = 9.8e-22 Identity = 54/67 (80.60%), Postives = 60/67 (89.55%), Query Frame = 0
BLAST of Carg23731 vs. NCBI nr
Match: XP_004134248.1 (PREDICTED: calmodulin-A [Cucumis sativus]) HSP 1 Score: 110.5 bits (275), Expect = 2.2e-21 Identity = 54/67 (80.60%), Postives = 57/67 (85.07%), Query Frame = 0
BLAST of Carg23731 vs. TAIR10
Match: AT5G49480.1 (Ca2+-binding protein 1) HSP 1 Score: 80.5 bits (197), Expect = 4.4e-16 Identity = 36/60 (60.00%), Postives = 50/60 (83.33%), Query Frame = 0
BLAST of Carg23731 vs. Swiss-Prot
Match: sp|Q9FDX6|CP1_ARATH (Calcium-binding protein CP1 OS=Arabidopsis thaliana OX=3702 GN=CP1 PE=2 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 7.9e-15 Identity = 36/60 (60.00%), Postives = 50/60 (83.33%), Query Frame = 0
BLAST of Carg23731 vs. TrEMBL
Match: tr|A0A1S3AXP3|A0A1S3AXP3_CUCME (calmodulin OS=Cucumis melo OX=3656 GN=LOC103483899 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 6.5e-22 Identity = 54/67 (80.60%), Postives = 58/67 (86.57%), Query Frame = 0
BLAST of Carg23731 vs. TrEMBL
Match: tr|A0A0A0L828|A0A0A0L828_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G167380 PE=4 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.4e-21 Identity = 54/67 (80.60%), Postives = 57/67 (85.07%), Query Frame = 0
BLAST of Carg23731 vs. TrEMBL
Match: tr|A0A061EP14|A0A061EP14_THECC (Ca2+-binding protein 1 OS=Theobroma cacao OX=3641 GN=TCM_021387 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 3.7e-17 Identity = 45/64 (70.31%), Postives = 57/64 (89.06%), Query Frame = 0
BLAST of Carg23731 vs. TrEMBL
Match: tr|A0A2P4K6H1|A0A2P4K6H1_QUESU (Squidulin OS=Quercus suber OX=58331 GN=CFP56_61540 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.1e-16 Identity = 43/64 (67.19%), Postives = 55/64 (85.94%), Query Frame = 0
BLAST of Carg23731 vs. TrEMBL
Match: tr|A0A1R3GK73|A0A1R3GK73_9ROSI (Calcium-binding EF-hand OS=Corchorus olitorius OX=93759 GN=COLO4_34598 PE=4 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 1.1e-16 Identity = 44/64 (68.75%), Postives = 56/64 (87.50%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|