Carg18828 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAAGCCAACAAGACATTAGCCACAGCGTCGGCGAGGCCGTCGGCCAAGCTCAGGTAGTTTACCGCAACCAAATCGATATCAAACGCAGCCGTTTAGAACATATTATATATTTCAATTATTGTGTCAGGTGAAGAAGGATGAGGTCATCAACCAAGCAGCTAATTCAGCTCAAGAAGCAAAAGACAGCGCATCTACTACCCTTGATCAATCCTCAGCTGCCCAAACTGCCTCTGACCTCAAGGACCAAGCTGCAAATTTCCTTCAACAGGCAAATTTGTTATTGGAAAAAACTATATTTTAAAAAATTTGCAAATGGGTCCTTACAAAATTGCTTATTTATTTATTTTGATATGGTTTAGACTGGAGAGCAAGTGAAGAACATGGCTCAAGGAGCAGCTGAGGCAGTGAAAAACACTCTTGGGATGAACACTGATAGCAGTTCTAACGCCGCCGCCAACACCAACAACCCTACCAACACTCCATCCCCTACAATCTAA ATGGCAAGCCAACAAGACATTAGCCACAGCGTCGGCGAGGCCGTCGGCCAAGCTCAGGTGAAGAAGGATGAGACTGGAGAGCAAGTGAAGAACATGGCTCAAGGAGCAGCTGAGGCAGTGAAAAACACTCTTGGGATGAACACTGATAGCAGTTCTAACGCCGCCGCCAACACCAACAACCCTACCAACACTCCATCCCCTACAATCTAA ATGGCAAGCCAACAAGACATTAGCCACAGCGTCGGCGAGGCCGTCGGCCAAGCTCAGGTGAAGAAGGATGAGACTGGAGAGCAAGTGAAGAACATGGCTCAAGGAGCAGCTGAGGCAGTGAAAAACACTCTTGGGATGAACACTGATAGCAGTTCTAACGCCGCCGCCAACACCAACAACCCTACCAACACTCCATCCCCTACAATCTAA MASQQDISHSVGEAVGQAQVKKDETGEQVKNMAQGAAEAVKNTLGMNTDSSSNAAANTNNPTNTPSPTI
BLAST of Carg18828 vs. NCBI nr
Match: XP_008461082.1 (PREDICTED: late embryogenesis abundant protein 1 [Cucumis melo]) HSP 1 Score: 63.5 bits (153), Expect = 3.1e-07 Identity = 43/78 (55.13%), Postives = 44/78 (56.41%), Query Frame = 0
BLAST of Carg18828 vs. NCBI nr
Match: OMO54276.1 (late embryogenesis abundant protein 1-like protein [Corchorus capsularis]) HSP 1 Score: 61.2 bits (147), Expect = 1.6e-06 Identity = 34/51 (66.67%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of Carg18828 vs. NCBI nr
Match: OMP00153.1 (late embryogenesis abundant protein 1-like protein [Corchorus olitorius]) HSP 1 Score: 61.2 bits (147), Expect = 1.6e-06 Identity = 34/51 (66.67%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of Carg18828 vs. NCBI nr
Match: XP_022991676.1 (late embryogenesis abundant protein 1-like [Cucurbita maxima]) HSP 1 Score: 60.8 bits (146), Expect = 2.0e-06 Identity = 39/81 (48.15%), Postives = 44/81 (54.32%), Query Frame = 0
BLAST of Carg18828 vs. NCBI nr
Match: XP_021298725.1 (late embryogenesis abundant protein 2-like [Herrania umbratica]) HSP 1 Score: 59.7 bits (143), Expect = 4.5e-06 Identity = 41/83 (49.40%), Postives = 45/83 (54.22%), Query Frame = 0
BLAST of Carg18828 vs. TAIR10
Match: AT1G52680.1 (late embryogenesis abundant protein-related / LEA protein-related) HSP 1 Score: 47.0 bits (110), Expect = 5.5e-06 Identity = 34/91 (37.36%), Postives = 40/91 (43.96%), Query Frame = 0
BLAST of Carg18828 vs. TAIR10
Match: AT1G15415.1 (The protein encoded by this gene was identified as a part of pollen proteome by mass spec analysis. It has weak homology to LEA (late embryo abundant) proteins. Encodes protein phosphatase 2A (PP2A) B'gamma subunit. Targeted to nucleus and cytosol.) HSP 1 Score: 42.4 bits (98), Expect = 1.4e-04 Identity = 30/66 (45.45%), Postives = 40/66 (60.61%), Query Frame = 0
BLAST of Carg18828 vs. TrEMBL
Match: tr|A0A1S3CF46|A0A1S3CF46_CUCME (late embryogenesis abundant protein 1 OS=Cucumis melo OX=3656 GN=LOC103499779 PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 2.1e-07 Identity = 43/78 (55.13%), Postives = 44/78 (56.41%), Query Frame = 0
BLAST of Carg18828 vs. TrEMBL
Match: tr|A0A1R3G895|A0A1R3G895_COCAP (Late embryogenesis abundant protein 1-like protein OS=Corchorus capsularis OX=210143 GN=CCACVL1_27923 PE=4 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 1.0e-06 Identity = 34/51 (66.67%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of Carg18828 vs. TrEMBL
Match: tr|A0A1R3JZ79|A0A1R3JZ79_9ROSI (Late embryogenesis abundant protein 1-like protein OS=Corchorus olitorius OX=93759 GN=COLO4_12894 PE=4 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 1.0e-06 Identity = 34/51 (66.67%), Postives = 39/51 (76.47%), Query Frame = 0
BLAST of Carg18828 vs. TrEMBL
Match: tr|B9GKX8|B9GKX8_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_001G172900v3 PE=4 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 5.7e-05 Identity = 35/71 (49.30%), Postives = 39/71 (54.93%), Query Frame = 0
BLAST of Carg18828 vs. TrEMBL
Match: tr|A0A061GBL6|A0A061GBL6_THECC (Uncharacterized protein OS=Theobroma cacao OX=3641 GN=TCM_028329 PE=4 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 9.7e-05 Identity = 39/83 (46.99%), Postives = 45/83 (54.22%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|