Cucsa.105240 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAAGCCATCAGGATCTTAGCCACAAGGCTGATGAGATTGTTGGCCAGGCTCAGGTTAAGAGAGATGAGATGATGAACCAACCCACTACTCAGGACCAATCATCTGCTGCCCAAACTGCGACTGACCTCAAGGATCAAGCCGCAAGTTTCCTTCAACAGGTGATTTTTTtATATTGTTATTGTTATTTAATTAGCAAAATGAATGAACTAAAATGATTTTTGGTGTGAAATAATAATGTGTATAGACTGGAGAGCAAGTGAAGAACATGGCACAAGGAGCCGCTGAGGCAGTGAAGAACACACTTGGGATGAACACTGATAACACTTCAAACACCAACACCCACAATCCAGCCAACAATTCAGCCAACAATCCTACCAACAATCCAGCCAACAACCCTACCAGCAATCCAACCAGCAATCCTACCAGCAATCCATCCACTAGAATTTAA ATGGCAAGCCATCAGGATCTTAGCCACAAGGCTGATGAGATTGTTGGCCAGGCTCAGGTTAAGAGAGATGAGATGATGAACCAACCCACTACTCAGGACCAATCATCTGCTGCCCAAACTGCGACTGACCTCAAGGATCAAGCCGCAAGTTTCCTTCAACAGACTGGAGAGCAAGTGAAGAACATGGCACAAGGAGCCGCTGAGGCAGTGAAGAACACACTTGGGATGAACACTGATAACACTTCAAACaccaacacccacaatccagccaacaattcagccaacaatcctaccaacaatccagccaacaaccctaccagcaatccaaccagcaatcctaccagcaatccatccaCTAGAATTTAA ATGGCAAGCCATCAGGATCTTAGCCACAAGGCTGATGAGATTGTTGGCCAGGCTCAGGTTAAGAGAGATGAGATGATGAACCAACCCACTACTCAGGACCAATCATCTGCTGCCCAAACTGCGACTGACCTCAAGGATCAAGCCGCAAGTTTCCTTCAACAGACTGGAGAGCAAGTGAAGAACATGGCACAAGGAGCCGCTGAGGCAGTGAAGAACACACTTGGGATGAACACTGATAACACTTCAAACACCAACACCCACAATCCAGCCAACAATTCAGCCAACAATCCTACCAACAATCCAGCCAACAACCCTACCAGCAATCCAACCAGCAATCCTACCAGCAATCCATCCACTAGAATTTAA MASHQDLSHKADEIVGQAQVKRDEMMNQPTTQDQSSAAQTATDLKDQAASFLQQTGEQVKNMAQGAAEAVKNTLGMNTDNTSNTNTHNPANNSANNPTNNPANNPTSNPTSNPTSNPSTRI*
BLAST of Cucsa.105240 vs. Swiss-Prot
Match: LEA1_CICAR (Late embryogenesis abundant protein 1 OS=Cicer arietinum PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.2e-08 Identity = 37/82 (45.12%), Postives = 45/82 (54.88%), Query Frame = 1
BLAST of Cucsa.105240 vs. Swiss-Prot
Match: LEA2_CICAR (Late embryogenesis abundant protein 2 OS=Cicer arietinum PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.2e-08 Identity = 37/87 (42.53%), Postives = 45/87 (51.72%), Query Frame = 1
BLAST of Cucsa.105240 vs. Swiss-Prot
Match: LEA76_BRANA (Late embryogenesis abundant protein 76 OS=Brassica napus PE=2 SV=2) HSP 1 Score: 55.5 bits (132), Expect = 4.9e-07 Identity = 34/93 (36.56%), Postives = 48/93 (51.61%), Query Frame = 1
BLAST of Cucsa.105240 vs. Swiss-Prot
Match: DPOL_ASFL6 (DNA polymerase beta OS=African swine fever virus (isolate Pig/Portugal/Lis 60/1960) GN=DPOL PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 6.4e-07 Identity = 25/66 (37.88%), Postives = 30/66 (45.45%), Query Frame = 1
HSP 2 Score: 51.6 bits (122), Expect = 7.0e-06 Identity = 34/118 (28.81%), Postives = 45/118 (38.14%), Query Frame = 1
BLAST of Cucsa.105240 vs. Swiss-Prot
Match: LEA3_WHEAT (Late embryogenesis abundant protein, group 3 OS=Triticum aestivum PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 7.0e-06 Identity = 32/90 (35.56%), Postives = 39/90 (43.33%), Query Frame = 1
BLAST of Cucsa.105240 vs. TrEMBL
Match: A0A0A0K8V2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G433240 PE=4 SV=1) HSP 1 Score: 245.4 bits (625), Expect = 3.7e-62 Identity = 121/121 (100.00%), Postives = 121/121 (100.00%), Query Frame = 1
BLAST of Cucsa.105240 vs. TrEMBL
Match: B9RV16_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0898010 PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 2.1e-20 Identity = 62/125 (49.60%), Postives = 78/125 (62.40%), Query Frame = 1
BLAST of Cucsa.105240 vs. TrEMBL
Match: B9GKX8_POPTR (Late embryogenesis abundant family protein OS=Populus trichocarpa GN=POPTR_0001s17300g PE=4 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 3.0e-19 Identity = 65/122 (53.28%), Postives = 78/122 (63.93%), Query Frame = 1
BLAST of Cucsa.105240 vs. TrEMBL
Match: A0A061GBL6_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_028329 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 3.3e-18 Identity = 49/94 (52.13%), Postives = 67/94 (71.28%), Query Frame = 1
BLAST of Cucsa.105240 vs. TrEMBL
Match: A0A059BSC4_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_F02549 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 6.8e-16 Identity = 51/107 (47.66%), Postives = 71/107 (66.36%), Query Frame = 1
BLAST of Cucsa.105240 vs. TAIR10
Match: AT1G52680.1 (AT1G52680.1 late embryogenesis abundant protein-related / LEA protein-related) HSP 1 Score: 79.3 bits (194), Expect = 1.8e-15 Identity = 49/118 (41.53%), Postives = 64/118 (54.24%), Query Frame = 1
BLAST of Cucsa.105240 vs. TAIR10
Match: AT1G15415.1 (AT1G15415.1 The protein encoded by this gene was identified as a part of pollen proteome by mass spec analysis. It has weak homology to LEA (late embryo abundant) proteins. Encodes protein phosphatase 2A (PP2A) B'gamma subunit. Targeted to nucleus and cytosol.) HSP 1 Score: 68.9 bits (167), Expect = 2.4e-12 Identity = 43/104 (41.35%), Postives = 55/104 (52.88%), Query Frame = 1
BLAST of Cucsa.105240 vs. TAIR10
Match: AT4G13560.1 (AT4G13560.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 53.1 bits (126), Expect = 1.4e-07 Identity = 33/73 (45.21%), Postives = 42/73 (57.53%), Query Frame = 1
BLAST of Cucsa.105240 vs. TAIR10
Match: AT3G15670.1 (AT3G15670.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 53.1 bits (126), Expect = 1.4e-07 Identity = 37/99 (37.37%), Postives = 49/99 (49.49%), Query Frame = 1
BLAST of Cucsa.105240 vs. TAIR10
Match: AT1G52690.1 (AT1G52690.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 50.4 bits (119), Expect = 8.8e-07 Identity = 27/94 (28.72%), Postives = 46/94 (48.94%), Query Frame = 1
BLAST of Cucsa.105240 vs. NCBI nr
Match: gi|449436603|ref|XP_004136082.1| (PREDICTED: late embryogenesis abundant protein 2 [Cucumis sativus]) HSP 1 Score: 245.4 bits (625), Expect = 5.3e-62 Identity = 121/121 (100.00%), Postives = 121/121 (100.00%), Query Frame = 1
BLAST of Cucsa.105240 vs. NCBI nr
Match: gi|659122328|ref|XP_008461082.1| (PREDICTED: late embryogenesis abundant protein 1 [Cucumis melo]) HSP 1 Score: 190.7 bits (483), Expect = 1.5e-45 Identity = 98/122 (80.33%), Postives = 108/122 (88.52%), Query Frame = 1
BLAST of Cucsa.105240 vs. NCBI nr
Match: gi|1009174423|ref|XP_015868339.1| (PREDICTED: late embryogenesis abundant protein 2-like [Ziziphus jujuba]) HSP 1 Score: 114.4 bits (285), Expect = 1.4e-22 Identity = 66/117 (56.41%), Postives = 80/117 (68.38%), Query Frame = 1
BLAST of Cucsa.105240 vs. NCBI nr
Match: gi|657961014|ref|XP_008372090.1| (PREDICTED: late embryogenesis abundant protein, group 3-like [Malus domestica]) HSP 1 Score: 111.7 bits (278), Expect = 9.1e-22 Identity = 71/151 (47.02%), Postives = 84/151 (55.63%), Query Frame = 1
BLAST of Cucsa.105240 vs. NCBI nr
Match: gi|470134235|ref|XP_004302960.1| (PREDICTED: late embryogenesis abundant protein 1 [Fragaria vesca subsp. vesca]) HSP 1 Score: 110.5 bits (275), Expect = 2.0e-21 Identity = 70/136 (51.47%), Postives = 84/136 (61.76%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|