Carg16415 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.AGAAGAAGCGTTAATGTTGTGATGGAGGCGAAACGCGGTACGAAGAAGTCTCGCAGTGGTAGTAGCAATAGTAGTAAAAGGCAACAATACGAAGCTCCTCTTGGTTACATTATTGAAGACGTTCGTCCACACGGTGGTATTGAGAAGTTCCGATCTGCTGCGTATTCCAACGTAAGATTGTTCTTCGATTTCTTCGATTTCTTCGAGTTCTTGAGTAGTTTTGTGATTTCTTGCGTTGTAATTGTGTTTTTCTTGTTGATTTTCTGGCAGTGCGTGAGGAAACCATCCTGATACCTTTTGTCTCTGTAGATTACGAGTTCTGA AGAAGAAGCGTTAATGTTGTGATGGAGGCGAAACGCGGTACGAAGAAGTCTCGCAGTGGTAGTAGCAATAGTAGTAAAAGGCAACAATACGAAGCTCCTCTTGGTTACATTATTGAAGACGTTCGTCCACACGGTGGTATTGAGAAGTTCCGATCTGCTGCGTATTCCAACGTAAGATTGTTCTTCGATTTCTTCGATTTCTTCGAGTTCTTGATGCGTGAGGAAACCATCCTGATACCTTTTGTCTCTGTAGATTACGAGTTCTGA AGAAGAAGCGTTAATGTTGTGATGGAGGCGAAACGCGGTACGAAGAAGTCTCGCAGTGGTAGTAGCAATAGTAGTAAAAGGCAACAATACGAAGCTCCTCTTGGTTACATTATTGAAGACGTTCGTCCACACGGTGGTATTGAGAAGTTCCGATCTGCTGCGTATTCCAACGTAAGATTGTTCTTCGATTTCTTCGATTTCTTCGAGTTCTTGATGCGTGAGGAAACCATCCTGATACCTTTTGTCTCTGTAGATTACGAGTTCTGA RRSVNVVMEAKRGTKKSRSGSSNSSKRQQYEAPLGYIIEDVRPHGGIEKFRSAAYSNVRLFFDFFDFFEFLMREETILIPFVSVDYEF
BLAST of Carg16415 vs. NCBI nr
Match: XP_023536821.1 (S-adenosylmethionine decarboxylase proenzyme-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 94.4 bits (233), Expect = 2.1e-16 Identity = 47/50 (94.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of Carg16415 vs. NCBI nr
Match: OAE18299.1 (hypothetical protein AXG93_436s1300 [Marchantia polymorpha subsp. ruderalis]) HSP 1 Score: 75.9 bits (185), Expect = 7.8e-11 Identity = 36/59 (61.02%), Postives = 47/59 (79.66%), Query Frame = 0
BLAST of Carg16415 vs. NCBI nr
Match: ONK69697.1 (uncharacterized protein A4U43_C05F25790 [Asparagus officinalis]) HSP 1 Score: 73.9 bits (180), Expect = 3.0e-10 Identity = 39/54 (72.22%), Postives = 42/54 (77.78%), Query Frame = 0
BLAST of Carg16415 vs. NCBI nr
Match: RDY02299.1 (S-adenosylmethionine decarboxylase proenzyme, partial [Mucuna pruriens]) HSP 1 Score: 73.6 bits (179), Expect = 3.9e-10 Identity = 40/60 (66.67%), Postives = 44/60 (73.33%), Query Frame = 0
BLAST of Carg16415 vs. NCBI nr
Match: ESR66778.1 (hypothetical protein CICLE_v10010716mg, partial [Citrus clementina]) HSP 1 Score: 72.8 bits (177), Expect = 6.6e-10 Identity = 38/58 (65.52%), Postives = 44/58 (75.86%), Query Frame = 0
BLAST of Carg16415 vs. TAIR10
Match: AT3G25572.1 (conserved peptide upstream open reading frame 11) HSP 1 Score: 61.6 bits (148), Expect = 2.8e-10 Identity = 35/53 (66.04%), Postives = 39/53 (73.58%), Query Frame = 0
BLAST of Carg16415 vs. TAIR10
Match: AT5G15948.1 (conserved peptide upstream open reading frame 10) HSP 1 Score: 60.1 bits (144), Expect = 8.0e-10 Identity = 32/50 (64.00%), Postives = 36/50 (72.00%), Query Frame = 0
BLAST of Carg16415 vs. TAIR10
Match: AT3G02468.1 (conserved peptide upstream open reading frame 9) HSP 1 Score: 53.5 bits (127), Expect = 7.5e-08 Identity = 22/28 (78.57%), Postives = 26/28 (92.86%), Query Frame = 0
BLAST of Carg16415 vs. TrEMBL
Match: tr|A0A176VBL3|A0A176VBL3_MARPO (Uncharacterized protein OS=Marchantia polymorpha subsp. ruderalis OX=1480154 GN=AXG93_436s1300 PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 5.2e-11 Identity = 36/59 (61.02%), Postives = 47/59 (79.66%), Query Frame = 0
BLAST of Carg16415 vs. TrEMBL
Match: tr|V4U1S8|V4U1S8_9ROSI (Uncharacterized protein (Fragment) OS=Citrus clementina OX=85681 GN=CICLE_v10010716mg PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 4.4e-10 Identity = 38/58 (65.52%), Postives = 44/58 (75.86%), Query Frame = 0
BLAST of Carg16415 vs. TrEMBL
Match: tr|M5X8C0|M5X8C0_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica OX=3760 GN=PRUPE_ppb015242mg PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 7.5e-10 Identity = 39/60 (65.00%), Postives = 45/60 (75.00%), Query Frame = 0
BLAST of Carg16415 vs. TrEMBL
Match: tr|A0A059ADW4|A0A059ADW4_EUCGR (Uncharacterized protein (Fragment) OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_J01448 PE=4 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 9.7e-10 Identity = 38/57 (66.67%), Postives = 44/57 (77.19%), Query Frame = 0
BLAST of Carg16415 vs. TrEMBL
Match: tr|A0A1R3J120|A0A1R3J120_COCAP (S-adenosylmethionine decarboxylase OS=Corchorus capsularis OX=210143 GN=CCACVL1_08337 PE=4 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 1.3e-09 Identity = 38/58 (65.52%), Postives = 45/58 (77.59%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|