Carg00789 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGTACAATCCTAGGGTTTCCAGTTCCCGCCGCAAGAGCCGTAAGGCTCATTTTTCGGCGCCGTCGAGCGTTCGTCGGGTTATTATGAGTGCTCCTCTCTCGACTGACCTCCGGTCAAAGTACAACGTCCGATCCATGCCGATTCGGAAGGATGATGAGGTCCAAGTTGTCCGTGGAACTTACAAGGGTCGGGAGGGCAAGGTAGTGCAGGTGTATCGTAAAAAGTGGGTTATCCATATCGAGCGCATCACTCGCGAAAAGGTTAACGGTTCCACTGTCAATGTTGGTATCAACCCCTCGAAGGTCGTGATTACGAAGCTCAGGCTGGACAAGGACCGCAAGTCACTTCTGGATCGTAAAGGCAAGGGCCGCGCCGCCTCTGATAAGGACAAGGGTACCAAGTTCACCGCCGAGGATATCATGCAGAGCGTCGACTAA ATGAAGTACAATCCTAGGGTTTCCAGTTCCCGCCGCAAGAGCCGTAAGGCTCATTTTTCGGCGCCGTCGAGCGTTCGTCGGGTTATTATGAGTGCTCCTCTCTCGACTGACCTCCGGTCAAAGTACAACGTCCGATCCATGCCGATTCGGAAGGATGATGAGGTCCAAGTTGTCCGTGGAACTTACAAGGGTCGGGAGGGCAAGGTAGTGCAGGTGTATCGTAAAAAGTGGGTTATCCATATCGAGCGCATCACTCGCGAAAAGGTTAACGGTTCCACTGTCAATGTTGGTATCAACCCCTCGAAGGTCGTGATTACGAAGCTCAGGCTGGACAAGGACCGCAAGTCACTTCTGGATCGTAAAGGCAAGGGCCGCGCCGCCTCTGATAAGGACAAGGGTACCAAGTTCACCGCCGAGGATATCATGCAGAGCGTCGACTAA ATGAAGTACAATCCTAGGGTTTCCAGTTCCCGCCGCAAGAGCCGTAAGGCTCATTTTTCGGCGCCGTCGAGCGTTCGTCGGGTTATTATGAGTGCTCCTCTCTCGACTGACCTCCGGTCAAAGTACAACGTCCGATCCATGCCGATTCGGAAGGATGATGAGGTCCAAGTTGTCCGTGGAACTTACAAGGGTCGGGAGGGCAAGGTAGTGCAGGTGTATCGTAAAAAGTGGGTTATCCATATCGAGCGCATCACTCGCGAAAAGGTTAACGGTTCCACTGTCAATGTTGGTATCAACCCCTCGAAGGTCGTGATTACGAAGCTCAGGCTGGACAAGGACCGCAAGTCACTTCTGGATCGTAAAGGCAAGGGCCGCGCCGCCTCTGATAAGGACAAGGGTACCAAGTTCACCGCCGAGGATATCATGCAGAGCGTCGACTAA MKYNPRVSSSRRKSRKAHFSAPSSVRRVIMSAPLSTDLRSKYNVRSMPIRKDDEVQVVRGTYKGREGKVVQVYRKKWVIHIERITREKVNGSTVNVGINPSKVVITKLRLDKDRKSLLDRKGKGRAASDKDKGTKFTAEDIMQSVD
BLAST of Carg00789 vs. NCBI nr
Match: XP_022950899.1 (60S ribosomal protein L26-1 [Cucurbita moschata] >XP_022978626.1 60S ribosomal protein L26-1 [Cucurbita maxima] >XP_023543127.1 60S ribosomal protein L26-1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 278.5 bits (711), Expect = 1.3e-71 Identity = 146/146 (100.00%), Postives = 146/146 (100.00%), Query Frame = 0
BLAST of Carg00789 vs. NCBI nr
Match: XP_004141862.1 (PREDICTED: 60S ribosomal protein L26-1 [Cucumis sativus] >XP_008440392.1 PREDICTED: 60S ribosomal protein L26-1 [Cucumis melo] >KGN48613.1 hypothetical protein Csa_6G495670 [Cucumis sativus]) HSP 1 Score: 273.5 bits (698), Expect = 4.2e-70 Identity = 142/146 (97.26%), Postives = 145/146 (99.32%), Query Frame = 0
BLAST of Carg00789 vs. NCBI nr
Match: XP_022963400.1 (60S ribosomal protein L26-1-like [Cucurbita moschata] >XP_023003724.1 60S ribosomal protein L26-1-like [Cucurbita maxima] >XP_023517131.1 60S ribosomal protein L26-1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 272.7 bits (696), Expect = 7.2e-70 Identity = 142/146 (97.26%), Postives = 145/146 (99.32%), Query Frame = 0
BLAST of Carg00789 vs. NCBI nr
Match: XP_022132426.1 (60S ribosomal protein L26-1 [Momordica charantia]) HSP 1 Score: 271.6 bits (693), Expect = 1.6e-69 Identity = 141/146 (96.58%), Postives = 145/146 (99.32%), Query Frame = 0
BLAST of Carg00789 vs. NCBI nr
Match: XP_016720131.1 (PREDICTED: 60S ribosomal protein L26-1 [Gossypium hirsutum] >XP_017623657.1 PREDICTED: 60S ribosomal protein L26-1 [Gossypium arboreum] >PPD90443.1 hypothetical protein GOBAR_DD12629 [Gossypium barbadense] >PPR91561.1 hypothetical protein GOBAR_AA29119 [Gossypium barbadense]) HSP 1 Score: 270.0 bits (689), Expect = 4.7e-69 Identity = 139/146 (95.21%), Postives = 145/146 (99.32%), Query Frame = 0
BLAST of Carg00789 vs. TAIR10
Match: AT3G49910.1 (Translation protein SH3-like family protein) HSP 1 Score: 252.7 bits (644), Expect = 1.4e-67 Identity = 128/146 (87.67%), Postives = 141/146 (96.58%), Query Frame = 0
BLAST of Carg00789 vs. TAIR10
Match: AT5G67510.1 (Translation protein SH3-like family protein) HSP 1 Score: 244.2 bits (622), Expect = 5.0e-65 Identity = 122/146 (83.56%), Postives = 141/146 (96.58%), Query Frame = 0
BLAST of Carg00789 vs. Swiss-Prot
Match: sp|P51414|RL261_ARATH (60S ribosomal protein L26-1 OS=Arabidopsis thaliana OX=3702 GN=RPL26A PE=2 SV=2) HSP 1 Score: 252.7 bits (644), Expect = 2.5e-66 Identity = 128/146 (87.67%), Postives = 141/146 (96.58%), Query Frame = 0
BLAST of Carg00789 vs. Swiss-Prot
Match: sp|Q9FJX2|RL262_ARATH (60S ribosomal protein L26-2 OS=Arabidopsis thaliana OX=3702 GN=RPL26B PE=2 SV=1) HSP 1 Score: 244.2 bits (622), Expect = 9.0e-64 Identity = 122/146 (83.56%), Postives = 141/146 (96.58%), Query Frame = 0
BLAST of Carg00789 vs. Swiss-Prot
Match: sp|Q39411|RL26_BRACM (60S ribosomal protein L26 OS=Brassica campestris OX=3711 GN=RPL26 PE=2 SV=1) HSP 1 Score: 233.4 bits (594), Expect = 1.6e-60 Identity = 118/145 (81.38%), Postives = 134/145 (92.41%), Query Frame = 0
BLAST of Carg00789 vs. Swiss-Prot
Match: sp|P61257|RL26_BOVIN (60S ribosomal protein L26 OS=Bos taurus OX=9913 GN=RPL26 PE=2 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 1.6e-44 Identity = 98/142 (69.01%), Postives = 119/142 (83.80%), Query Frame = 0
BLAST of Carg00789 vs. Swiss-Prot
Match: sp|P61254|RL26_HUMAN (60S ribosomal protein L26 OS=Homo sapiens OX=9606 GN=RPL26 PE=1 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 1.6e-44 Identity = 98/142 (69.01%), Postives = 119/142 (83.80%), Query Frame = 0
BLAST of Carg00789 vs. TrEMBL
Match: tr|A0A1S3B106|A0A1S3B106_CUCME (60S ribosomal protein L26-1 OS=Cucumis melo OX=3656 GN=LOC103484854 PE=4 SV=1) HSP 1 Score: 273.5 bits (698), Expect = 2.8e-70 Identity = 142/146 (97.26%), Postives = 145/146 (99.32%), Query Frame = 0
BLAST of Carg00789 vs. TrEMBL
Match: tr|A0A0A0KGI0|A0A0A0KGI0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G495670 PE=4 SV=1) HSP 1 Score: 273.5 bits (698), Expect = 2.8e-70 Identity = 142/146 (97.26%), Postives = 145/146 (99.32%), Query Frame = 0
BLAST of Carg00789 vs. TrEMBL
Match: tr|A0A2P5RUI9|A0A2P5RUI9_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_AA29119 PE=3 SV=1) HSP 1 Score: 270.0 bits (689), Expect = 3.1e-69 Identity = 139/146 (95.21%), Postives = 145/146 (99.32%), Query Frame = 0
BLAST of Carg00789 vs. TrEMBL
Match: tr|A0A1U8LZY4|A0A1U8LZY4_GOSHI (60S ribosomal protein L26-1 OS=Gossypium hirsutum OX=3635 GN=LOC107932587 PE=3 SV=1) HSP 1 Score: 270.0 bits (689), Expect = 3.1e-69 Identity = 139/146 (95.21%), Postives = 145/146 (99.32%), Query Frame = 0
BLAST of Carg00789 vs. TrEMBL
Match: tr|A0A1R3I630|A0A1R3I630_COCAP (Ribosomal protein L26/L24P, eukaryotic/archaeal OS=Corchorus capsularis OX=210143 GN=CCACVL1_14727 PE=3 SV=1) HSP 1 Score: 269.6 bits (688), Expect = 4.0e-69 Identity = 138/146 (94.52%), Postives = 145/146 (99.32%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |