MELO3C008528 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGAAAAAATGCCAGAGGCACAAACTGCTATTGTTAACTCTAGCACTGTTTCTGGGCAAAATGGTAGTAATTTGAACCAGCTTTCCACCGAGAGCCTTTCAATGAGCATAAACTCACGTTTGGAGTCGAATGGCATTTCAAAAAGTCAAACCTTATCAACTGGAATCAAAACAGTAAACGAGAAGGCAGAATGGGTTGTACAAGACGAACCAGGCGTGTATATAACTTTGTCTGCTTTGCCTGGAGGATTCAATGAGCTGAAACGAGTTCGTTTCAGGTACTAAATTTAGCTCCCTTTTTGTGAAAGTTTATTGAGCGCTTACATGACATTAAATTTTACTTGATAGTATGATGGCTTTGTCATCAATCCATATCTTTCTAGTGCTGATTGTTGGAATTCCTTACCTCATCGTAACCCCTTAA ATGGCTGAAAAAATGCCAGAGGCACAAACTGCTATTGTTAACTCTAGCACTGTTTCTGGGCAAAATGGTAGTAATTTGAACCAGCTTTCCACCGAGAGCCTTTCAATGAGCATAAACTCACGTTTGGAGTCGAATGGCATTTCAAAAAGTCAAACCTTATCAACTGGAATCAAAACAGTAAACGAGAAGGCAGAATGGGTTGTACAAGACGAACCAGGCGTGTATATAACTTTGTCTGCTTTGCCTGGAGGATTCAATGAGCTGAAACGAGTTCGTTTCAGTATGATGGCTTTGTCATCAATCCATATCTTTCTAGTGCTGATTGTTGGAATTCCTTACCTCATCGTAACCCCTTAA ATGGCTGAAAAAATGCCAGAGGCACAAACTGCTATTGTTAACTCTAGCACTGTTTCTGGGCAAAATGGTAGTAATTTGAACCAGCTTTCCACCGAGAGCCTTTCAATGAGCATAAACTCACGTTTGGAGTCGAATGGCATTTCAAAAAGTCAAACCTTATCAACTGGAATCAAAACAGTAAACGAGAAGGCAGAATGGGTTGTACAAGACGAACCAGGCGTGTATATAACTTTGTCTGCTTTGCCTGGAGGATTCAATGAGCTGAAACGAGTTCGTTTCAGTATGATGGCTTTGTCATCAATCCATATCTTTCTAGTGCTGATTGTTGGAATTCCTTACCTCATCGTAACCCCTTAA MAEKMPEAQTAIVNSSTVSGQNGSNLNQLSTESLSMSINSRLESNGISKSQTLSTGIKTVNEKAEWVVQDEPGVYITLSALPGGFNELKRVRFSMMALSSIHIFLVLIVGIPYLIVTP*
BLAST of MELO3C008528 vs. Swiss-Prot
Match: BRXL1_ORYSJ (Protein Brevis radix-like 1 OS=Oryza sativa subsp. japonica GN=BRXL1 PE=2 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.6e-10 Identity = 35/82 (42.68%), Postives = 50/82 (60.98%), Query Frame = 1
HSP 2 Score: 45.8 bits (107), Expect = 3.8e-04 Identity = 21/34 (61.76%), Postives = 23/34 (67.65%), Query Frame = 1
BLAST of MELO3C008528 vs. Swiss-Prot
Match: BRXL3_ARATH (Protein Brevis radix-like 3 OS=Arabidopsis thaliana GN=BRXL3 PE=2 SV=2) HSP 1 Score: 58.2 bits (139), Expect = 7.3e-08 Identity = 29/72 (40.28%), Postives = 42/72 (58.33%), Query Frame = 1
HSP 2 Score: 43.9 bits (102), Expect = 1.4e-03 Identity = 20/33 (60.61%), Postives = 22/33 (66.67%), Query Frame = 1
BLAST of MELO3C008528 vs. Swiss-Prot
Match: BRXL4_ARATH (Protein Brevis radix-like 4 OS=Arabidopsis thaliana GN=BRXL4 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 2.1e-07 Identity = 32/72 (44.44%), Postives = 38/72 (52.78%), Query Frame = 1
HSP 2 Score: 48.5 bits (114), Expect = 5.8e-05 Identity = 22/33 (66.67%), Postives = 23/33 (69.70%), Query Frame = 1
BLAST of MELO3C008528 vs. Swiss-Prot
Match: BRXL2_ARATH (Protein Brevis radix-like 2 OS=Arabidopsis thaliana GN=BRXL2 PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 3.1e-06 Identity = 31/85 (36.47%), Postives = 42/85 (49.41%), Query Frame = 1
HSP 2 Score: 46.6 bits (109), Expect = 2.2e-04 Identity = 27/66 (40.91%), Postives = 34/66 (51.52%), Query Frame = 1
BLAST of MELO3C008528 vs. Swiss-Prot
Match: BRXL1_ARATH (Protein Brevis radix-like 1 OS=Arabidopsis thaliana GN=BRXL1 PE=2 SV=2) HSP 1 Score: 51.2 bits (121), Expect = 9.0e-06 Identity = 22/40 (55.00%), Postives = 25/40 (62.50%), Query Frame = 1
HSP 2 Score: 46.6 bits (109), Expect = 2.2e-04 Identity = 20/34 (58.82%), Postives = 24/34 (70.59%), Query Frame = 1
BLAST of MELO3C008528 vs. TrEMBL
Match: A0A0A0LN51_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G110220 PE=4 SV=1) HSP 1 Score: 173.7 bits (439), Expect = 1.3e-40 Identity = 88/94 (93.62%), Postives = 90/94 (95.74%), Query Frame = 1
BLAST of MELO3C008528 vs. TrEMBL
Match: F6HPD3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0026g02140 PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 4.3e-15 Identity = 48/95 (50.53%), Postives = 65/95 (68.42%), Query Frame = 1
BLAST of MELO3C008528 vs. TrEMBL
Match: W9QMX2_9ROSA (Putative E3 ubiquitin-protein ligase HERC1 OS=Morus notabilis GN=L484_006532 PE=4 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.6e-14 Identity = 49/96 (51.04%), Postives = 65/96 (67.71%), Query Frame = 1
BLAST of MELO3C008528 vs. TrEMBL
Match: M5XJC8_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa020628mg PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 4.0e-13 Identity = 47/94 (50.00%), Postives = 61/94 (64.89%), Query Frame = 1
BLAST of MELO3C008528 vs. TrEMBL
Match: B9S8T2_RICCO (Ran GTPase binding protein, putative OS=Ricinus communis GN=RCOM_0835650 PE=4 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 5.3e-13 Identity = 46/95 (48.42%), Postives = 62/95 (65.26%), Query Frame = 1
BLAST of MELO3C008528 vs. TAIR10
Match: AT1G69710.1 (AT1G69710.1 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain) HSP 1 Score: 68.2 bits (165), Expect = 4.0e-12 Identity = 42/97 (43.30%), Postives = 55/97 (56.70%), Query Frame = 1
BLAST of MELO3C008528 vs. TAIR10
Match: AT5G12350.1 (AT5G12350.1 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain) HSP 1 Score: 62.8 bits (151), Expect = 1.7e-10 Identity = 46/114 (40.35%), Postives = 56/114 (49.12%), Query Frame = 1
BLAST of MELO3C008528 vs. TAIR10
Match: AT1G54180.1 (AT1G54180.1 BREVIS RADIX-like 3) HSP 1 Score: 58.2 bits (139), Expect = 4.1e-09 Identity = 29/72 (40.28%), Postives = 42/72 (58.33%), Query Frame = 1
HSP 2 Score: 43.9 bits (102), Expect = 8.1e-05 Identity = 20/33 (60.61%), Postives = 22/33 (66.67%), Query Frame = 1
BLAST of MELO3C008528 vs. TAIR10
Match: AT5G20540.1 (AT5G20540.1 BREVIS RADIX-like 4) HSP 1 Score: 56.6 bits (135), Expect = 1.2e-08 Identity = 32/72 (44.44%), Postives = 38/72 (52.78%), Query Frame = 1
HSP 2 Score: 48.5 bits (114), Expect = 3.3e-06 Identity = 22/33 (66.67%), Postives = 23/33 (69.70%), Query Frame = 1
BLAST of MELO3C008528 vs. TAIR10
Match: AT5G19420.2 (AT5G19420.2 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain) HSP 1 Score: 55.8 bits (133), Expect = 2.0e-08 Identity = 35/78 (44.87%), Postives = 42/78 (53.85%), Query Frame = 1
BLAST of MELO3C008528 vs. NCBI nr
Match: gi|659082151|ref|XP_008441694.1| (PREDICTED: uncharacterized protein LOC103485768 isoform X3 [Cucumis melo]) HSP 1 Score: 182.6 bits (462), Expect = 4.1e-43 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 1
BLAST of MELO3C008528 vs. NCBI nr
Match: gi|659082147|ref|XP_008441692.1| (PREDICTED: uncharacterized protein LOC103485768 isoform X1 [Cucumis melo]) HSP 1 Score: 182.6 bits (462), Expect = 4.1e-43 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 1
BLAST of MELO3C008528 vs. NCBI nr
Match: gi|659082153|ref|XP_008441696.1| (PREDICTED: uncharacterized protein LOC103485768 isoform X4 [Cucumis melo]) HSP 1 Score: 182.6 bits (462), Expect = 4.1e-43 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 1
BLAST of MELO3C008528 vs. NCBI nr
Match: gi|700206277|gb|KGN61396.1| (hypothetical protein Csa_2G110220 [Cucumis sativus]) HSP 1 Score: 173.7 bits (439), Expect = 1.9e-40 Identity = 88/94 (93.62%), Postives = 90/94 (95.74%), Query Frame = 1
BLAST of MELO3C008528 vs. NCBI nr
Match: gi|296086391|emb|CBI31980.3| (unnamed protein product [Vitis vinifera]) HSP 1 Score: 89.0 bits (219), Expect = 6.2e-15 Identity = 48/95 (50.53%), Postives = 65/95 (68.42%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|