Cucsa.017030 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCATGTCAAAGAGAATGACACTTGTTTTTATTGGGATTCTCTTGGTTAGCTTCGACATGATTATGATCACAAATGCAAAAAAATTCATTGATTACGGTTCTATTGTTGCAGGAGATGTTAGCCCTGGATGTAGCCCAACGCACCCTGAACTTTGTAGAGTAAAGAGCGCAAATCCATACCAAAGAGGTTGCAATCGAATCGATCGTTGTAGAGAGGGAAATGATATTATTGACGCTGAAGAAGAACATATTGAAGGGGATGCATCGATTAGTCCTTCAATAAGCCCTAATATAGAGAATTAA ATGATCATGTCAAAGAGAATGACACTTGTTTTTATTGGGATTCTCTTGGTTAGCTTCGACATGATTATGATCACAAATGCAAAAAAATTCATTGATTACGGTTCTATTGTTGCAGGAGATGTTAGCCCTGGATGTAGCCCAACGCACCCTGAACTTTGTAGAGTAAAGAGCGCAAATCCATACCAAAGAGGTTGCAATCGAATCGATCGTTGTAGAGAGGGAAATGATATTATTGACGCTGAAGAAGAACATATTGAAGGGGATGCATCGATTAGTCCTTCAATAAGCCCTAATATAGAGAATTAA ATGATCATGTCAAAGAGAATGACACTTGTTTTTATTGGGATTCTCTTGGTTAGCTTCGACATGATTATGATCACAAATGCAAAAAAATTCATTGATTACGGTTCTATTGTTGCAGGAGATGTTAGCCCTGGATGTAGCCCAACGCACCCTGAACTTTGTAGAGTAAAGAGCGCAAATCCATACCAAAGAGGTTGCAATCGAATCGATCGTTGTAGAGAGGGAAATGATATTATTGACGCTGAAGAAGAACATATTGAAGGGGATGCATCGATTAGTCCTTCAATAAGCCCTAATATAGAGAATTAA MIMSKRMTLVFIGILLVSFDMIMITNAKKFIDYGSIVAGDVSPGCSPTHPELCRVKSANPYQRGCNRIDRCREGNDIIDAEEEHIEGDASISPSISPNIEN*
BLAST of Cucsa.017030 vs. Swiss-Prot
Match: RLF9_ARATH (Protein RALF-like 9 OS=Arabidopsis thaliana GN=RALFL9 PE=3 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 9.7e-09 Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 1
BLAST of Cucsa.017030 vs. Swiss-Prot
Match: RLF15_ARATH (Protein RALF-like 15 OS=Arabidopsis thaliana GN=RALFL15 PE=3 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 2.6e-06 Identity = 27/74 (36.49%), Postives = 42/74 (56.76%), Query Frame = 1
BLAST of Cucsa.017030 vs. TrEMBL
Match: A0A0A0L8B1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G426350 PE=4 SV=1) HSP 1 Score: 206.8 bits (525), Expect = 1.2e-50 Identity = 100/101 (99.01%), Postives = 101/101 (100.00%), Query Frame = 1
BLAST of Cucsa.017030 vs. TrEMBL
Match: V4UF46_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10018043mg PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.2e-08 Identity = 35/75 (46.67%), Postives = 50/75 (66.67%), Query Frame = 1
BLAST of Cucsa.017030 vs. TrEMBL
Match: A0A067F0E4_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g041712mg PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 1.2e-08 Identity = 35/75 (46.67%), Postives = 50/75 (66.67%), Query Frame = 1
BLAST of Cucsa.017030 vs. TrEMBL
Match: R0I9N4_9BRAS (Uncharacterized protein OS=Capsella rubella GN=CARUB_v10022412mg PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.4e-06 Identity = 30/73 (41.10%), Postives = 40/73 (54.79%), Query Frame = 1
BLAST of Cucsa.017030 vs. TrEMBL
Match: D7KVJ4_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_893358 PE=4 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.4e-06 Identity = 30/76 (39.47%), Postives = 43/76 (56.58%), Query Frame = 1
BLAST of Cucsa.017030 vs. TAIR10
Match: AT1G61566.1 (AT1G61566.1 ralf-like 9) HSP 1 Score: 60.8 bits (146), Expect = 5.5e-10 Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 1
BLAST of Cucsa.017030 vs. TAIR10
Match: AT2G22055.1 (AT2G22055.1 RALF-like 15) HSP 1 Score: 52.8 bits (125), Expect = 1.5e-07 Identity = 27/74 (36.49%), Postives = 42/74 (56.76%), Query Frame = 1
BLAST of Cucsa.017030 vs. TAIR10
Match: AT1G61563.1 (AT1G61563.1 ralf-like 8) HSP 1 Score: 48.5 bits (114), Expect = 2.8e-06 Identity = 26/74 (35.14%), Postives = 41/74 (55.41%), Query Frame = 1
BLAST of Cucsa.017030 vs. NCBI nr
Match: gi|700202865|gb|KGN57998.1| (hypothetical protein Csa_3G426350 [Cucumis sativus]) HSP 1 Score: 206.8 bits (525), Expect = 1.7e-50 Identity = 100/101 (99.01%), Postives = 101/101 (100.00%), Query Frame = 1
BLAST of Cucsa.017030 vs. NCBI nr
Match: gi|567910725|ref|XP_006447676.1| (hypothetical protein CICLE_v10018043mg [Citrus clementina]) HSP 1 Score: 67.4 bits (163), Expect = 1.7e-08 Identity = 35/75 (46.67%), Postives = 50/75 (66.67%), Query Frame = 1
BLAST of Cucsa.017030 vs. NCBI nr
Match: gi|18407238|ref|NP_564779.1| (protein RALF-like 9 [Arabidopsis thaliana]) HSP 1 Score: 60.8 bits (146), Expect = 1.5e-06 Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 1
BLAST of Cucsa.017030 vs. NCBI nr
Match: gi|565488585|ref|XP_006301932.1| (hypothetical protein CARUB_v10022412mg [Capsella rubella]) HSP 1 Score: 60.5 bits (145), Expect = 2.0e-06 Identity = 30/73 (41.10%), Postives = 40/73 (54.79%), Query Frame = 1
BLAST of Cucsa.017030 vs. NCBI nr
Match: gi|21592626|gb|AAM64575.1| (unknown [Arabidopsis thaliana]) HSP 1 Score: 59.7 bits (143), Expect = 3.4e-06 Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |