Csa4G280660 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.GATTGGGAAAATCTTTGGAGTGGGAAAGAGAATGGCAAGGTACAACTACTACTACCGCTATCCTTACTTGGAGTACTTGACATTGCCTCCTTTGCAGCTTTGTGTGTTTGTTGTGATCCTTTTGGTGGTGATGGCCTTTTCATGGTACTTCTTCTACTATTCATTTCTTGAAGATTTTATCTTCCAACTCAAGCTCTTCCTTCTCACTGTCCCCTTGCTTCTCCTCCTCCTCCTCCACCTCCTCTCTTTCGGCTTCTCCTTTCTCCTCCCTTTACCCGAGCAGGACTCCCTCCATCGTGCTGGTGGCTCACCCTGGGGCGTCGCCATCCTCCTCGTCTTCTTTCTCTATGTTATCTCTCACCAGTCTCATTACCACCAACGTTGGTTTCCTTTCGGATATAGATAA ATGGCAAGGTACAACTACTACTACCGCTATCCTTACTTGGAGTACTTGACATTGCCTCCTTTGCAGCTTTGTGTGTTTGTTGTGATCCTTTTGGTGGTGATGGCCTTTTCATGGTACTTCTTCTACTATTCATTTCTTGAAGATTTTATCTTCCAACTCAAGCTCTTCCTTCTCACTGTCCCCTTGCTTCTCCTCCTCCTCCTCCACCTCCTCTCTTTCGGCTTCTCCTTTCTCCTCCCTTTACCCGAGCAGGACTCCCTCCATCGTGCTGGTGGCTCACCCTGGGGCGTCGCCATCCTCCTCGTCTTCTTTCTCTATGTTATCTCTCACCAGTCTCATTACCACCAACGTTGGTTTCCTTTCGGATATAGATAA ATGGCAAGGTACAACTACTACTACCGCTATCCTTACTTGGAGTACTTGACATTGCCTCCTTTGCAGCTTTGTGTGTTTGTTGTGATCCTTTTGGTGGTGATGGCCTTTTCATGGTACTTCTTCTACTATTCATTTCTTGAAGATTTTATCTTCCAACTCAAGCTCTTCCTTCTCACTGTCCCCTTGCTTCTCCTCCTCCTCCTCCACCTCCTCTCTTTCGGCTTCTCCTTTCTCCTCCCTTTACCCGAGCAGGACTCCCTCCATCGTGCTGGTGGCTCACCCTGGGGCGTCGCCATCCTCCTCGTCTTCTTTCTCTATGTTATCTCTCACCAGTCTCATTACCACCAACGTTGGTTTCCTTTCGGATATAGATAA MARYNYYYRYPYLEYLTLPPLQLCVFVVILLVVMAFSWYFFYYSFLEDFIFQLKLFLLTVPLLLLLLLHLLSFGFSFLLPLPEQDSLHRAGGSPWGVAILLVFFLYVISHQSHYHQRWFPFGYR*
BLAST of Csa4G280660 vs. TrEMBL
Match: A0A0A0KZ55_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G280660 PE=4 SV=1) HSP 1 Score: 262.3 bits (669), Expect = 3.0e-67 Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
BLAST of Csa4G280660 vs. TrEMBL
Match: A0A061GR99_THECC (Uncharacterized protein OS=Theobroma cacao GN=TCM_040264 PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 1.9e-37 Identity = 75/116 (64.66%), Postives = 89/116 (76.72%), Query Frame = 1
BLAST of Csa4G280660 vs. TrEMBL
Match: A0A0D2VJW7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_013G248300 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 3.6e-36 Identity = 72/116 (62.07%), Postives = 90/116 (77.59%), Query Frame = 1
BLAST of Csa4G280660 vs. TrEMBL
Match: A0A0L9UVE5_PHAAN (Uncharacterized protein OS=Phaseolus angularis GN=LR48_Vigan07g053900 PE=4 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 8.2e-33 Identity = 74/127 (58.27%), Postives = 95/127 (74.80%), Query Frame = 1
BLAST of Csa4G280660 vs. TrEMBL
Match: A0A0S3RKH3_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.03G070000 PE=4 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 8.2e-33 Identity = 74/127 (58.27%), Postives = 95/127 (74.80%), Query Frame = 1
BLAST of Csa4G280660 vs. TAIR10
Match: AT5G19875.1 (AT5G19875.1 unknown protein) HSP 1 Score: 134.8 bits (338), Expect = 3.6e-32 Identity = 59/116 (50.86%), Postives = 79/116 (68.10%), Query Frame = 1
BLAST of Csa4G280660 vs. TAIR10
Match: AT2G31940.1 (AT2G31940.1 unknown protein) HSP 1 Score: 110.2 bits (274), Expect = 9.6e-25 Identity = 53/107 (49.53%), Postives = 71/107 (66.36%), Query Frame = 1
BLAST of Csa4G280660 vs. TAIR10
Match: AT5G42146.1 (AT5G42146.1 unknown protein) HSP 1 Score: 67.0 bits (162), Expect = 9.3e-12 Identity = 36/108 (33.33%), Postives = 57/108 (52.78%), Query Frame = 1
BLAST of Csa4G280660 vs. TAIR10
Match: AT2G21180.1 (AT2G21180.1 unknown protein) HSP 1 Score: 51.2 bits (121), Expect = 5.3e-07 Identity = 36/123 (29.27%), Postives = 53/123 (43.09%), Query Frame = 1
BLAST of Csa4G280660 vs. NCBI nr
Match: gi|700198931|gb|KGN54089.1| (hypothetical protein Csa_4G280660 [Cucumis sativus]) HSP 1 Score: 262.3 bits (669), Expect = 4.3e-67 Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
BLAST of Csa4G280660 vs. NCBI nr
Match: gi|590582936|ref|XP_007014761.1| (Uncharacterized protein TCM_040264 [Theobroma cacao]) HSP 1 Score: 163.3 bits (412), Expect = 2.7e-37 Identity = 75/116 (64.66%), Postives = 89/116 (76.72%), Query Frame = 1
BLAST of Csa4G280660 vs. NCBI nr
Match: gi|823259654|ref|XP_012462541.1| (PREDICTED: uncharacterized protein LOC105782384 [Gossypium raimondii]) HSP 1 Score: 159.1 bits (401), Expect = 5.1e-36 Identity = 72/116 (62.07%), Postives = 90/116 (77.59%), Query Frame = 1
BLAST of Csa4G280660 vs. NCBI nr
Match: gi|920703610|gb|KOM46835.1| (hypothetical protein LR48_Vigan07g053900 [Vigna angularis]) HSP 1 Score: 147.9 bits (372), Expect = 1.2e-32 Identity = 74/127 (58.27%), Postives = 95/127 (74.80%), Query Frame = 1
BLAST of Csa4G280660 vs. NCBI nr
Match: gi|763754500|gb|KJB21831.1| (hypothetical protein B456_004G017800 [Gossypium raimondii]) HSP 1 Score: 147.9 bits (372), Expect = 1.2e-32 Identity = 69/125 (55.20%), Postives = 92/125 (73.60%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|