MELO3C022515 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAGAGGAAAGACTCAGATGAGGTTAATAGAGAACGCTACAAGCCGTCAAGTCACCTTCTCCAAGAGGAGAAATGGTTTGATGAAAAAAGCTTTTGAGTTATCGGTTCTCTGTGATGCTGAAGTTGCTCTTATCATCTTCTCCCCTAGAGGAAAGCTTTATGAATTTGCTAGCTCAAGGTTAACCTTTTTTTTTAATCTCTAGCTCTATTCTTTTTGTTACCAATTTTAGCGTGATGGATTGTGATCTGAATTTGAATCTGATCTAA ATGGTGAGAGGAAAGACTCAGATGAGGTTAATAGAGAACGCTACAAGCCGTCAAGTCACCTTCTCCAAGAGGAGAAATGGTTTGATGAAAAAAGCTTTTGAGTTATCGGTTCTCTGTGATGCTGAAGTTGCTCTTATCATCTTCTCCCCTAGAGGAAAGCTTTATGAATTTGCTAGCTCAAGCGTGATGGATTGTGATCTGAATTTGAATCTGATCTAA ATGGTGAGAGGAAAGACTCAGATGAGGTTAATAGAGAACGCTACAAGCCGTCAAGTCACCTTCTCCAAGAGGAGAAATGGTTTGATGAAAAAAGCTTTTGAGTTATCGGTTCTCTGTGATGCTGAAGTTGCTCTTATCATCTTCTCCCCTAGAGGAAAGCTTTATGAATTTGCTAGCTCAAGCGTGATGGATTGTGATCTGAATTTGAATCTGATCTAA MVRGKTQMRLIENATSRQVTFSKRRNGLMKKAFELSVLCDAEVALIIFSPRGKLYEFASSSVMDCDLNLNLI*
BLAST of MELO3C022515 vs. Swiss-Prot
Match: SOC1_ARATH (MADS-box protein SOC1 OS=Arabidopsis thaliana GN=SOC1 PE=1 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 6.9e-25 Identity = 56/64 (87.50%), Postives = 60/64 (93.75%), Query Frame = 1
BLAST of MELO3C022515 vs. Swiss-Prot
Match: AGL14_ARATH (Agamous-like MADS-box protein AGL14 OS=Arabidopsis thaliana GN=AGL14 PE=1 SV=2) HSP 1 Score: 112.5 bits (280), Expect = 2.0e-24 Identity = 56/61 (91.80%), Postives = 58/61 (95.08%), Query Frame = 1
BLAST of MELO3C022515 vs. Swiss-Prot
Match: MAD50_ORYSJ (MADS-box transcription factor 50 OS=Oryza sativa subsp. japonica GN=MADS50 PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 4.5e-24 Identity = 55/61 (90.16%), Postives = 57/61 (93.44%), Query Frame = 1
BLAST of MELO3C022515 vs. Swiss-Prot
Match: AGL19_ARATH (Agamous-like MADS-box protein AGL19 OS=Arabidopsis thaliana GN=AGL19 PE=1 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 5.8e-24 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 1
BLAST of MELO3C022515 vs. Swiss-Prot
Match: MAD56_ORYSJ (MADS-box transcription factor 56 OS=Oryza sativa subsp. japonica GN=MADS56 PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 3.2e-22 Identity = 50/60 (83.33%), Postives = 56/60 (93.33%), Query Frame = 1
BLAST of MELO3C022515 vs. TrEMBL
Match: Q1EMR8_PLAMJ (MADS-box transcription factor OS=Plantago major GN=soc1 PE=2 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.1e-24 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 1
BLAST of MELO3C022515 vs. TrEMBL
Match: A0A0B2P657_GLYSO (MADS-box protein SOC1 OS=Glycine soja GN=glysoja_042100 PE=4 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.1e-24 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 1
BLAST of MELO3C022515 vs. TrEMBL
Match: A1XG54_SOYBN (SOC1 OS=Glycine max GN=GLYMA_18G224500 PE=2 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 3.1e-24 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 1
BLAST of MELO3C022515 vs. TrEMBL
Match: A0A022QZQ2_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a013555mg PE=4 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 5.3e-24 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 1
BLAST of MELO3C022515 vs. TrEMBL
Match: I1L6S0_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_09G266200 PE=4 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 7.0e-24 Identity = 59/64 (92.19%), Postives = 62/64 (96.88%), Query Frame = 1
BLAST of MELO3C022515 vs. TAIR10
Match: AT2G45660.1 (AT2G45660.1 AGAMOUS-like 20) HSP 1 Score: 114.0 bits (284), Expect = 3.9e-26 Identity = 56/64 (87.50%), Postives = 60/64 (93.75%), Query Frame = 1
BLAST of MELO3C022515 vs. TAIR10
Match: AT4G11880.1 (AT4G11880.1 AGAMOUS-like 14) HSP 1 Score: 112.5 bits (280), Expect = 1.1e-25 Identity = 56/61 (91.80%), Postives = 58/61 (95.08%), Query Frame = 1
BLAST of MELO3C022515 vs. TAIR10
Match: AT4G22950.1 (AT4G22950.1 AGAMOUS-like 19) HSP 1 Score: 110.9 bits (276), Expect = 3.3e-25 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 1
BLAST of MELO3C022515 vs. TAIR10
Match: AT5G62165.1 (AT5G62165.1 AGAMOUS-like 42) HSP 1 Score: 100.1 bits (248), Expect = 5.8e-22 Identity = 48/62 (77.42%), Postives = 56/62 (90.32%), Query Frame = 1
BLAST of MELO3C022515 vs. TAIR10
Match: AT1G24260.2 (AT1G24260.2 K-box region and MADS-box transcription factor family protein ) HSP 1 Score: 95.1 bits (235), Expect = 1.9e-20 Identity = 47/63 (74.60%), Postives = 53/63 (84.13%), Query Frame = 1
BLAST of MELO3C022515 vs. NCBI nr
Match: gi|659120339|ref|XP_008460142.1| (PREDICTED: MADS-box protein SOC1-like [Cucumis melo]) HSP 1 Score: 119.8 bits (299), Expect = 2.0e-24 Identity = 61/62 (98.39%), Postives = 62/62 (100.00%), Query Frame = 1
BLAST of MELO3C022515 vs. NCBI nr
Match: gi|449471671|ref|XP_004153376.1| (PREDICTED: MADS-box protein SOC1-like [Cucumis sativus]) HSP 1 Score: 118.6 bits (296), Expect = 4.5e-24 Identity = 60/62 (96.77%), Postives = 62/62 (100.00%), Query Frame = 1
BLAST of MELO3C022515 vs. NCBI nr
Match: gi|351726978|ref|NP_001236377.1| (SOC1 [Glycine max]) HSP 1 Score: 118.6 bits (296), Expect = 4.5e-24 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 1
BLAST of MELO3C022515 vs. NCBI nr
Match: gi|106879569|emb|CAJ38368.1| (MADS-box transcription factor [Plantago major]) HSP 1 Score: 118.6 bits (296), Expect = 4.5e-24 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 1
BLAST of MELO3C022515 vs. NCBI nr
Match: gi|1000982184|ref|XP_002511767.2| (PREDICTED: MADS-box protein SOC1 isoform X1 [Ricinus communis]) HSP 1 Score: 118.2 bits (295), Expect = 5.8e-24 Identity = 59/64 (92.19%), Postives = 62/64 (96.88%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |