MELO3C021376 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAAGCGCAGTAGATGCCGTAGGAGATCCAATTCCTACATCGGCGGTGCTAATTTCTTCCTCAAAGCACATTGCGAACGATTGTCTGTCGGAGAACGTGGCATACCTTCAGTGCAGACGGAAGGATCCGAACCCGGAGAAATGCCTGGACAAAGGCCATCAAGTCAATCGATGCGTTCTCTCCCTGTAA ATGGCAAGCGCAGTAGATGCCGTAGGAGATCCAATTCCTACATCGGCGGTGCTAATTTCTTCCTCAAAGCACATTGCGAACGATTGTCTGTCGGAGAACGTGGCATACCTTCAGTGCAGACGGAAGGATCCGAACCCGGAGAAATGCCTGGACAAAGGCCATCAAGTCAATCGATGCGTTCTCTCCCTGTAA ATGGCAAGCGCAGTAGATGCCGTAGGAGATCCAATTCCTACATCGGCGGTGCTAATTTCTTCCTCAAAGCACATTGCGAACGATTGTCTGTCGGAGAACGTGGCATACCTTCAGTGCAGACGGAAGGATCCGAACCCGGAGAAATGCCTGGACAAAGGCCATCAAGTCAATCGATGCGTTCTCTCCCTGTAA MASAVDAVGDPIPTSAVLISSSKHIANDCLSENVAYLQCRRKDPNPEKCLDKGHQVNRCVLSL*
BLAST of MELO3C021376 vs. Swiss-Prot
Match: NDA8B_ARATH (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-B OS=Arabidopsis thaliana GN=At5g18800 PE=1 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.3e-19 Identity = 43/63 (68.25%), Postives = 50/63 (79.37%), Query Frame = 1
BLAST of MELO3C021376 vs. Swiss-Prot
Match: NDA8A_ARATH (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8-A OS=Arabidopsis thaliana GN=At3g06310 PE=2 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 3.6e-17 Identity = 38/61 (62.30%), Postives = 47/61 (77.05%), Query Frame = 1
BLAST of MELO3C021376 vs. TrEMBL
Match: A0A0A0LY30_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G538810 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 2.3e-23 Identity = 55/63 (87.30%), Postives = 58/63 (92.06%), Query Frame = 1
BLAST of MELO3C021376 vs. TrEMBL
Match: M5XT71_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa013741mg PE=4 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 7.0e-20 Identity = 48/63 (76.19%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of MELO3C021376 vs. TrEMBL
Match: A0A124SBQ3_CYNCS (CHCH-like protein OS=Cynara cardunculus var. scolymus GN=Ccrd_006593 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 9.1e-20 Identity = 48/63 (76.19%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of MELO3C021376 vs. TrEMBL
Match: A0A103XIP0_CYNCS (CHCH-like protein OS=Cynara cardunculus var. scolymus GN=Ccrd_006519 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 2.0e-19 Identity = 46/63 (73.02%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of MELO3C021376 vs. TrEMBL
Match: A0A067KV02_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_02044 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 2.6e-19 Identity = 46/63 (73.02%), Postives = 54/63 (85.71%), Query Frame = 1
BLAST of MELO3C021376 vs. TAIR10
Match: AT5G18800.1 (AT5G18800.1 Cox19-like CHCH family protein) HSP 1 Score: 96.3 bits (238), Expect = 7.4e-21 Identity = 43/63 (68.25%), Postives = 50/63 (79.37%), Query Frame = 1
BLAST of MELO3C021376 vs. TAIR10
Match: AT3G06310.1 (AT3G06310.1 Cox19-like CHCH family protein) HSP 1 Score: 88.2 bits (217), Expect = 2.0e-18 Identity = 38/61 (62.30%), Postives = 47/61 (77.05%), Query Frame = 1
BLAST of MELO3C021376 vs. NCBI nr
Match: gi|449435544|ref|XP_004135555.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 115.5 bits (288), Expect = 3.3e-23 Identity = 55/63 (87.30%), Postives = 58/63 (92.06%), Query Frame = 1
BLAST of MELO3C021376 vs. NCBI nr
Match: gi|596195955|ref|XP_007223574.1| (hypothetical protein PRUPE_ppa013741mg [Prunus persica]) HSP 1 Score: 104.0 bits (258), Expect = 1.0e-19 Identity = 48/63 (76.19%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of MELO3C021376 vs. NCBI nr
Match: gi|976903510|gb|KVH91387.1| (CHCH-like protein [Cynara cardunculus var. scolymus]) HSP 1 Score: 103.6 bits (257), Expect = 1.3e-19 Identity = 48/63 (76.19%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of MELO3C021376 vs. NCBI nr
Match: gi|976903651|gb|KVH91458.1| (CHCH-like protein [Cynara cardunculus var. scolymus]) HSP 1 Score: 102.4 bits (254), Expect = 2.9e-19 Identity = 46/63 (73.02%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of MELO3C021376 vs. NCBI nr
Match: gi|643733099|gb|KDP40046.1| (hypothetical protein JCGZ_02044 [Jatropha curcas]) HSP 1 Score: 102.1 bits (253), Expect = 3.8e-19 Identity = 46/63 (73.02%), Postives = 54/63 (85.71%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |