MELO3C019422 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAGGAAAGATTAAATGAGCATGTTATTGATTATGATCTTCTCGAAGATTTAGTGATTCATGTGGATAAAACTTTTGATGAGGGAGCCATACTTGTTTTCTTGCCAGTAAGTTATTGTTGTTCTCTGCATTTTTATTTTTATTAGTATTGCTTTTTATTTTTTTTAACTTCAAAACTGTTTCGCATAACAGGGAGTGTCAGAAATTCACTTGTTGTATGATAGATTAGCTGCTTCTTACCAATTTGGTGGACAGGCTTCTGATTGGATTCTTCCTTTGCATTCGTCCATTGCATCTACTGATCAAAAAAAGGTGTTTTTACGGCCTCCTTATGGCATCCGCAAGGCAAGTTTTGTAACATACAGGGGCTACTTCTAA ATGCAGGAAAGATTAAATGAGCATGTTATTGATTATGATCTTCTCGAAGATTTAGTGATTCATGTGGATAAAACTTTTGATGAGGGAGCCATACTTGTTTTCTTGCCAGGAGTGTCAGAAATTCACTTGTTGTATGATAGATTAGCTGCTTCTTACCAATTTGGTGGACAGGCTTCTGATTGGATTCTTCCTTTGCATTCGTCCATTGCATCTACTGATCAAAAAAAGGTGTTTTTACGGCCTCCTTATGGCATCCGCAAGGCAAGTTTTGTAACATACAGGGGCTACTTCTAA ATGCAGGAAAGATTAAATGAGCATGTTATTGATTATGATCTTCTCGAAGATTTAGTGATTCATGTGGATAAAACTTTTGATGAGGGAGCCATACTTGTTTTCTTGCCAGGAGTGTCAGAAATTCACTTGTTGTATGATAGATTAGCTGCTTCTTACCAATTTGGTGGACAGGCTTCTGATTGGATTCTTCCTTTGCATTCGTCCATTGCATCTACTGATCAAAAAAAGGTGTTTTTACGGCCTCCTTATGGCATCCGCAAGGCAAGTTTTGTAACATACAGGGGCTACTTCTAA MQERLNEHVIDYDLLEDLVIHVDKTFDEGAILVFLPGVSEIHLLYDRLAASYQFGGQASDWILPLHSSIASTDQKKVFLRPPYGIRKASFVTYRGYF*
BLAST of MELO3C019422 vs. Swiss-Prot
Match: DEXH7_ARATH (DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.1e-28 Identity = 59/90 (65.56%), Postives = 74/90 (82.22%), Query Frame = 1
BLAST of MELO3C019422 vs. Swiss-Prot
Match: DEXH4_ARATH (DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 1.8e-28 Identity = 59/84 (70.24%), Postives = 70/84 (83.33%), Query Frame = 1
BLAST of MELO3C019422 vs. Swiss-Prot
Match: DHX30_BOVIN (Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.6e-11 Identity = 39/91 (42.86%), Postives = 51/91 (56.04%), Query Frame = 1
BLAST of MELO3C019422 vs. Swiss-Prot
Match: DHX30_RAT (Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.6e-11 Identity = 39/91 (42.86%), Postives = 51/91 (56.04%), Query Frame = 1
BLAST of MELO3C019422 vs. Swiss-Prot
Match: DHX30_PONAB (Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.6e-11 Identity = 39/91 (42.86%), Postives = 51/91 (56.04%), Query Frame = 1
BLAST of MELO3C019422 vs. TrEMBL
Match: A0A0A0L9F8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G228370 PE=4 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 3.8e-41 Identity = 85/90 (94.44%), Postives = 86/90 (95.56%), Query Frame = 1
BLAST of MELO3C019422 vs. TrEMBL
Match: M5XY08_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa000230mg PE=4 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 2.1e-31 Identity = 70/90 (77.78%), Postives = 78/90 (86.67%), Query Frame = 1
BLAST of MELO3C019422 vs. TrEMBL
Match: B9SSN0_RICCO (ATP-dependent RNA helicase, putative OS=Ricinus communis GN=RCOM_1374260 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 6.0e-31 Identity = 66/90 (73.33%), Postives = 78/90 (86.67%), Query Frame = 1
BLAST of MELO3C019422 vs. TrEMBL
Match: V4SBK4_9ROSI (Uncharacterized protein (Fragment) OS=Citrus clementina GN=CICLE_v100000301mg PE=4 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 3.9e-30 Identity = 68/90 (75.56%), Postives = 76/90 (84.44%), Query Frame = 1
BLAST of MELO3C019422 vs. TrEMBL
Match: V4SVZ1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v100000301mg PE=4 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 3.9e-30 Identity = 68/90 (75.56%), Postives = 76/90 (84.44%), Query Frame = 1
BLAST of MELO3C019422 vs. TAIR10
Match: AT1G58060.1 (AT1G58060.1 RNA helicase family protein) HSP 1 Score: 127.1 bits (318), Expect = 6.0e-30 Identity = 59/90 (65.56%), Postives = 74/90 (82.22%), Query Frame = 1
BLAST of MELO3C019422 vs. TAIR10
Match: AT1G58050.1 (AT1G58050.1 RNA helicase family protein) HSP 1 Score: 126.3 bits (316), Expect = 1.0e-29 Identity = 59/84 (70.24%), Postives = 70/84 (83.33%), Query Frame = 1
BLAST of MELO3C019422 vs. TAIR10
Match: AT2G30800.1 (AT2G30800.1 helicase in vascular tissue and tapetum) HSP 1 Score: 60.5 bits (145), Expect = 6.9e-10 Identity = 34/88 (38.64%), Postives = 47/88 (53.41%), Query Frame = 1
BLAST of MELO3C019422 vs. TAIR10
Match: AT1G48650.2 (AT1G48650.2 DEA(D/H)-box RNA helicase family protein) HSP 1 Score: 58.9 bits (141), Expect = 2.0e-09 Identity = 31/83 (37.35%), Postives = 48/83 (57.83%), Query Frame = 1
BLAST of MELO3C019422 vs. TAIR10
Match: AT2G35920.1 (AT2G35920.1 RNA helicase family protein) HSP 1 Score: 57.8 bits (138), Expect = 4.4e-09 Identity = 31/83 (37.35%), Postives = 45/83 (54.22%), Query Frame = 1
BLAST of MELO3C019422 vs. NCBI nr
Match: gi|659112042|ref|XP_008456037.1| (PREDICTED: ATP-dependent RNA helicase DHX36 isoform X2 [Cucumis melo]) HSP 1 Score: 175.6 bits (444), Expect = 4.1e-41 Identity = 86/90 (95.56%), Postives = 86/90 (95.56%), Query Frame = 1
BLAST of MELO3C019422 vs. NCBI nr
Match: gi|659112040|ref|XP_008456036.1| (PREDICTED: ATP-dependent RNA helicase DHX29 isoform X1 [Cucumis melo]) HSP 1 Score: 175.6 bits (444), Expect = 4.1e-41 Identity = 86/90 (95.56%), Postives = 86/90 (95.56%), Query Frame = 1
BLAST of MELO3C019422 vs. NCBI nr
Match: gi|778680315|ref|XP_011651288.1| (PREDICTED: ATP-dependent RNA helicase DHX36 isoform X2 [Cucumis sativus]) HSP 1 Score: 175.3 bits (443), Expect = 5.4e-41 Identity = 85/90 (94.44%), Postives = 86/90 (95.56%), Query Frame = 1
BLAST of MELO3C019422 vs. NCBI nr
Match: gi|700202476|gb|KGN57609.1| (hypothetical protein Csa_3G228370 [Cucumis sativus]) HSP 1 Score: 175.3 bits (443), Expect = 5.4e-41 Identity = 85/90 (94.44%), Postives = 86/90 (95.56%), Query Frame = 1
BLAST of MELO3C019422 vs. NCBI nr
Match: gi|778680313|ref|XP_011651287.1| (PREDICTED: ATP-dependent RNA helicase DHX29 isoform X1 [Cucumis sativus]) HSP 1 Score: 175.3 bits (443), Expect = 5.4e-41 Identity = 85/90 (94.44%), Postives = 86/90 (95.56%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|