MELO3C011135 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGTACGAGGTGAAGCAGCAGAAACTTTGTATTTTGAAGCAAAATGTAGAATTGAAGATCCAATTTACGGATGTGTTGGGATTATTTCTCAATTACAATATGAATTACACGTGGCAGAAACCCAGTTGGCCAAGACTCGAGCTCAGATTGCTCTCCTCGCTTCCAACCTTCAACAAGCCCAACACGAAGCCCAAGCTTTTGCCTTTGATGACCCCAGCTCAGGCCCAATTTGTATTGGGCTCTCCACTCCAGCCCATTGGCTTCATTCTAGCTTTTCCGATTCATAA ATGGATGTACGAGGTGAAGCAGCAGAAACTTTGTATTTTGAAGCAAAATGTAGAATTGAAGATCCAATTTACGGATGTGTTGGGATTATTTCTCAATTACAATATGAATTACACGTGGCAGAAACCCAGTTGGCCAAGACTCGAGCTCAGATTGCTCTCCTCGCTTCCAACCTTCAACAAGCCCAACACGAAGCCCAAGCTTTTGCCTTTGATGACCCCAGCTCAGGCCCAATTTGTATTGGGCTCTCCACTCCAGCCCATTGGCTTCATTCTAGCTTTTCCGATTCATAA ATGGATGTACGAGGTGAAGCAGCAGAAACTTTGTATTTTGAAGCAAAATGTAGAATTGAAGATCCAATTTACGGATGTGTTGGGATTATTTCTCAATTACAATATGAATTACACGTGGCAGAAACCCAGTTGGCCAAGACTCGAGCTCAGATTGCTCTCCTCGCTTCCAACCTTCAACAAGCCCAACACGAAGCCCAAGCTTTTGCCTTTGATGACCCCAGCTCAGGCCCAATTTGTATTGGGCTCTCCACTCCAGCCCATTGGCTTCATTCTAGCTTTTCCGATTCATAA MDVRGEAAETLYFEAKCRIEDPIYGCVGIISQLQYELHVAETQLAKTRAQIALLASNLQQAQHEAQAFAFDDPSSGPICIGLSTPAHWLHSSFSDS*
BLAST of MELO3C011135 vs. Swiss-Prot
Match: LBD24_ARATH (LOB domain-containing protein 24 OS=Arabidopsis thaliana GN=LBD24 PE=2 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-11 Identity = 31/60 (51.67%), Postives = 43/60 (71.67%), Query Frame = 1
BLAST of MELO3C011135 vs. Swiss-Prot
Match: LBD23_ARATH (LOB domain-containing protein 23 OS=Arabidopsis thaliana GN=LBD23 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 5.8e-11 Identity = 30/57 (52.63%), Postives = 41/57 (71.93%), Query Frame = 1
BLAST of MELO3C011135 vs. Swiss-Prot
Match: LBD4_ARATH (LOB domain-containing protein 4 OS=Arabidopsis thaliana GN=LBD4 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.0e-07 Identity = 28/72 (38.89%), Postives = 38/72 (52.78%), Query Frame = 1
BLAST of MELO3C011135 vs. Swiss-Prot
Match: LBD3_ARATH (LOB domain-containing protein 3 OS=Arabidopsis thaliana GN=LBD3 PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.9e-06 Identity = 22/48 (45.83%), Postives = 32/48 (66.67%), Query Frame = 1
BLAST of MELO3C011135 vs. Swiss-Prot
Match: LBD13_ARATH (LOB domain-containing protein 13 OS=Arabidopsis thaliana GN=LBD13 PE=2 SV=2) HSP 1 Score: 52.4 bits (124), Expect = 3.3e-06 Identity = 22/48 (45.83%), Postives = 31/48 (64.58%), Query Frame = 1
BLAST of MELO3C011135 vs. TrEMBL
Match: A0A0A0LLX6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G373510 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 6.8e-35 Identity = 79/93 (84.95%), Postives = 82/93 (88.17%), Query Frame = 1
BLAST of MELO3C011135 vs. TrEMBL
Match: A0A0A0L9N7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G180300 PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.1e-24 Identity = 66/96 (68.75%), Postives = 77/96 (80.21%), Query Frame = 1
BLAST of MELO3C011135 vs. TrEMBL
Match: W9S930_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_005793 PE=4 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 7.3e-13 Identity = 42/73 (57.53%), Postives = 52/73 (71.23%), Query Frame = 1
BLAST of MELO3C011135 vs. TrEMBL
Match: W9RC85_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_013514 PE=4 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.3e-12 Identity = 36/62 (58.06%), Postives = 50/62 (80.65%), Query Frame = 1
BLAST of MELO3C011135 vs. TrEMBL
Match: A0A0B0PT25_GOSAR (LOB domain-containing 24-like protein OS=Gossypium arboreum GN=F383_07421 PE=4 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.1e-12 Identity = 35/60 (58.33%), Postives = 49/60 (81.67%), Query Frame = 1
BLAST of MELO3C011135 vs. TAIR10
Match: AT3G26660.1 (AT3G26660.1 LOB domain-containing protein 24) HSP 1 Score: 70.5 bits (171), Expect = 6.6e-13 Identity = 31/60 (51.67%), Postives = 43/60 (71.67%), Query Frame = 1
BLAST of MELO3C011135 vs. TAIR10
Match: AT3G26620.1 (AT3G26620.1 LOB domain-containing protein 23) HSP 1 Score: 68.2 bits (165), Expect = 3.3e-12 Identity = 30/57 (52.63%), Postives = 41/57 (71.93%), Query Frame = 1
BLAST of MELO3C011135 vs. TAIR10
Match: AT1G31320.1 (AT1G31320.1 LOB domain-containing protein 4) HSP 1 Score: 57.4 bits (137), Expect = 5.7e-09 Identity = 28/72 (38.89%), Postives = 38/72 (52.78%), Query Frame = 1
BLAST of MELO3C011135 vs. TAIR10
Match: AT1G16530.1 (AT1G16530.1 ASYMMETRIC LEAVES 2-like 9) HSP 1 Score: 53.1 bits (126), Expect = 1.1e-07 Identity = 22/48 (45.83%), Postives = 32/48 (66.67%), Query Frame = 1
BLAST of MELO3C011135 vs. TAIR10
Match: AT2G30340.1 (AT2G30340.1 LOB domain-containing protein 13) HSP 1 Score: 52.4 bits (124), Expect = 1.8e-07 Identity = 22/48 (45.83%), Postives = 31/48 (64.58%), Query Frame = 1
BLAST of MELO3C011135 vs. NCBI nr
Match: gi|659089563|ref|XP_008445577.1| (PREDICTED: LOB domain-containing protein 24-like [Cucumis melo]) HSP 1 Score: 196.4 bits (498), Expect = 2.2e-47 Identity = 96/96 (100.00%), Postives = 96/96 (100.00%), Query Frame = 1
BLAST of MELO3C011135 vs. NCBI nr
Match: gi|700207689|gb|KGN62808.1| (hypothetical protein Csa_2G373510 [Cucumis sativus]) HSP 1 Score: 154.5 bits (389), Expect = 9.8e-35 Identity = 79/93 (84.95%), Postives = 82/93 (88.17%), Query Frame = 1
BLAST of MELO3C011135 vs. NCBI nr
Match: gi|659077366|ref|XP_008439169.1| (PREDICTED: LOB domain-containing protein 24-like [Cucumis melo]) HSP 1 Score: 124.8 bits (312), Expect = 8.3e-26 Identity = 66/96 (68.75%), Postives = 77/96 (80.21%), Query Frame = 1
BLAST of MELO3C011135 vs. NCBI nr
Match: gi|449446189|ref|XP_004140854.1| (PREDICTED: LOB domain-containing protein 24-like [Cucumis sativus]) HSP 1 Score: 120.6 bits (301), Expect = 1.6e-24 Identity = 66/96 (68.75%), Postives = 77/96 (80.21%), Query Frame = 1
BLAST of MELO3C011135 vs. NCBI nr
Match: gi|1009139482|ref|XP_015887148.1| (PREDICTED: LOB domain-containing protein 24-like [Ziziphus jujuba]) HSP 1 Score: 84.0 bits (206), Expect = 1.6e-13 Identity = 39/60 (65.00%), Postives = 49/60 (81.67%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|