MELO3C010393 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.CACACAAACACACAAATTCATTATTCCTCCTTCCTCTTCTCCCCTTCCTTATAACAAAACCAAATGAAGAATTTTCCTATCACACTCGTTGTTTGCATTTTCGTGGTGGCAACCACGGTGGCTCTTCTTAACGGCCCTCCTCCAGTGGCTGCTCAGACGGTATGCGACGCATCTCAGCTCTCATCTTGCGCACCGGCATTTCTTTTTGGGGGAAATCCAAATCAGGAATGTTGCACAAAGTTGAGGGCAGAACAACCATGCTACTGTGAATATTTCGGAGATCCAAATTTGCAGAATTTCGTGAATTCTGATGCTGCTCGAAGGGTGGCTGAAGCCTGCAACATTACCTTCCCAACTATGGCTGACTGCCCTAACTAGAAACCCTACTTACTTGAATTTGGGCTCTTCTACAAGAATTAAGTATTATTATGTCTCTTAGTTTAATCTAATATAGAATATTCCGATCCCAACTAAAAATAAAGGGAAAACCATTGTGCTTTCTTTATAAATTAAAGGCTCAATATTATGTTCTAATTTACTGTCTTATCCATTATGAGTTAATAATAATAGGTCTGTCACGGATAGACACCTAAATCAGTGTTATGTCTATCACTCTCTTTTAAGGGTTTGATTGTGTTAATTTGTCAAATTTTCCTTCATTGCAAATATTAATTAAGCTCAAAATAATAACTCTAAATTTTCTCTCAA CACACAAACACACAAATTCATTATTCCTCCTTCCTCTTCTCCCCTTCCTTATAACAAAACCAAATGAAGAATTTTCCTATCACACTCGTTGTTTGCATTTTCGTGGTGGCAACCACGGTGGCTCTTCTTAACGGCCCTCCTCCAGTGGCTGCTCAGACGGTATGCGACGCATCTCAGCTCTCATCTTGCGCACCGGCATTTCTTTTTGGGGGAAATCCAAATCAGGAATGTTGCACAAAGTTGAGGGCAGAACAACCATGCTACTGTGAATATTTCGGAGATCCAAATTTGCAGAATTTCGTGAATTCTGATGCTGCTCGAAGGGTGGCTGAAGCCTGCAACATTACCTTCCCAACTATGGCTGACTGCCCTAACTAGAAACCCTACTTACTTGAATTTGGGCTCTTCTACAAGAATTAAGTATTATTATGTCTCTTAGTTTAATCTAATATAGAATATTCCGATCCCAACTAAAAATAAAGGGAAAACCATTGTGCTTTCTTTATAAATTAAAGGCTCAATATTATGTTCTAATTTACTGTCTTATCCATTATGAGTTAATAATAATAGGTCTGTCACGGATAGACACCTAAATCAGTGTTATGTCTATCACTCTCTTTTAAGGGTTTGATTGTGTTAATTTGTCAAATTTTCCTTCATTGCAAATATTAATTAAGCTCAAAATAATAACTCTAAATTTTCTCTCAA ATGAAGAATTTTCCTATCACACTCGTTGTTTGCATTTTCGTGGTGGCAACCACGGTGGCTCTTCTTAACGGCCCTCCTCCAGTGGCTGCTCAGACGGTATGCGACGCATCTCAGCTCTCATCTTGCGCACCGGCATTTCTTTTTGGGGGAAATCCAAATCAGGAATGTTGCACAAAGTTGAGGGCAGAACAACCATGCTACTGTGAATATTTCGGAGATCCAAATTTGCAGAATTTCGTGAATTCTGATGCTGCTCGAAGGGTGGCTGAAGCCTGCAACATTACCTTCCCAACTATGGCTGACTGCCCTAACTAG MKNFPITLVVCIFVVATTVALLNGPPPVAAQTVCDASQLSSCAPAFLFGGNPNQECCTKLRAEQPCYCEYFGDPNLQNFVNSDAARRVAEACNITFPTMADCPN*
BLAST of MELO3C010393 vs. Swiss-Prot
Match: NLTP_VIGUN (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata PE=2 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 2.5e-15 Identity = 36/89 (40.45%), Postives = 51/89 (57.30%), Query Frame = 1
BLAST of MELO3C010393 vs. Swiss-Prot
Match: NLTPX_ORYSI (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica GN=LTP-2 PE=3 SV=2) HSP 1 Score: 72.4 bits (176), Expect = 3.3e-12 Identity = 36/91 (39.56%), Postives = 46/91 (50.55%), Query Frame = 1
BLAST of MELO3C010393 vs. Swiss-Prot
Match: NLT2P_WHEAT (Non-specific lipid-transfer protein 2P OS=Triticum aestivum PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 9.6e-12 Identity = 29/64 (45.31%), Postives = 37/64 (57.81%), Query Frame = 1
BLAST of MELO3C010393 vs. Swiss-Prot
Match: NLT2G_WHEAT (Non-specific lipid-transfer protein 2G OS=Triticum aestivum PE=1 SV=2) HSP 1 Score: 70.1 bits (170), Expect = 1.6e-11 Identity = 35/97 (36.08%), Postives = 46/97 (47.42%), Query Frame = 1
BLAST of MELO3C010393 vs. Swiss-Prot
Match: NLTPX_ORYSJ (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. japonica GN=LTP-2 PE=1 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.1e-11 Identity = 35/91 (38.46%), Postives = 44/91 (48.35%), Query Frame = 1
BLAST of MELO3C010393 vs. TrEMBL
Match: A0A0A0KZL4_CUCSA (Putative lipid transfer protein family protein OS=Cucumis sativus GN=Csa_4G146240 PE=4 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 6.7e-36 Identity = 74/102 (72.55%), Postives = 83/102 (81.37%), Query Frame = 1
BLAST of MELO3C010393 vs. TrEMBL
Match: A0A022RLV0_ERYGU (Uncharacterized protein (Fragment) OS=Erythranthe guttata GN=MIMGU_mgv1a025902mg PE=4 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 8.5e-15 Identity = 37/90 (41.11%), Postives = 56/90 (62.22%), Query Frame = 1
BLAST of MELO3C010393 vs. TrEMBL
Match: A0A061EP56_THECC (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein, putative OS=Theobroma cacao GN=TCM_019372 PE=4 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.4e-14 Identity = 39/92 (42.39%), Postives = 54/92 (58.70%), Query Frame = 1
BLAST of MELO3C010393 vs. TrEMBL
Match: G7KV68_MEDTR (Lipid transfer protein OS=Medicago truncatula GN=MTR_7g082590 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.1e-13 Identity = 38/89 (42.70%), Postives = 52/89 (58.43%), Query Frame = 1
BLAST of MELO3C010393 vs. TrEMBL
Match: S4TID2_GOSHI (Lipid transfer protein OS=Gossypium hirsutum GN=LTP9 PE=4 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 6.1e-13 Identity = 35/88 (39.77%), Postives = 54/88 (61.36%), Query Frame = 1
BLAST of MELO3C010393 vs. TAIR10
Match: AT5G38170.1 (AT5G38170.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 75.9 bits (185), Expect = 1.7e-14 Identity = 37/91 (40.66%), Postives = 47/91 (51.65%), Query Frame = 1
BLAST of MELO3C010393 vs. TAIR10
Match: AT1G66850.1 (AT1G66850.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 69.7 bits (169), Expect = 1.2e-12 Identity = 35/102 (34.31%), Postives = 51/102 (50.00%), Query Frame = 1
BLAST of MELO3C010393 vs. TAIR10
Match: AT5G38160.1 (AT5G38160.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 69.7 bits (169), Expect = 1.2e-12 Identity = 36/101 (35.64%), Postives = 52/101 (51.49%), Query Frame = 1
BLAST of MELO3C010393 vs. TAIR10
Match: AT5G38195.1 (AT5G38195.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 69.3 bits (168), Expect = 1.6e-12 Identity = 29/89 (32.58%), Postives = 48/89 (53.93%), Query Frame = 1
BLAST of MELO3C010393 vs. TAIR10
Match: AT1G73780.1 (AT1G73780.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 64.7 bits (156), Expect = 3.9e-11 Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 1
BLAST of MELO3C010393 vs. NCBI nr
Match: gi|659086711|ref|XP_008444079.1| (PREDICTED: non-specific lipid-transfer protein 2P-like [Cucumis melo]) HSP 1 Score: 223.4 bits (568), Expect = 1.9e-55 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 1
BLAST of MELO3C010393 vs. NCBI nr
Match: gi|778692189|ref|XP_011653423.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis sativus]) HSP 1 Score: 157.9 bits (398), Expect = 9.6e-36 Identity = 74/102 (72.55%), Postives = 83/102 (81.37%), Query Frame = 1
BLAST of MELO3C010393 vs. NCBI nr
Match: gi|1012172738|ref|XP_015966141.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Arachis duranensis]) HSP 1 Score: 91.7 bits (226), Expect = 8.4e-16 Identity = 40/90 (44.44%), Postives = 54/90 (60.00%), Query Frame = 1
BLAST of MELO3C010393 vs. NCBI nr
Match: gi|604341514|gb|EYU40788.1| (hypothetical protein MIMGU_mgv1a025902mg, partial [Erythranthe guttata]) HSP 1 Score: 87.8 bits (216), Expect = 1.2e-14 Identity = 37/90 (41.11%), Postives = 56/90 (62.22%), Query Frame = 1
BLAST of MELO3C010393 vs. NCBI nr
Match: gi|590652591|ref|XP_007033193.1| (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein, putative [Theobroma cacao]) HSP 1 Score: 87.0 bits (214), Expect = 2.1e-14 Identity = 39/92 (42.39%), Postives = 54/92 (58.70%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|