Cla97C07G143390 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAAAGCTTCCGATCACAAGGCTTTGCCTTTTGGTGGTGACAATGGCCGCGCTCCTAACTGCAGCTCATCTTGCCGAGGCGGTGACTTGCAGCACTATGGAGCTTAGTCCATGCATGGGTGCAATAACGTCGACCGCACCACCGCCGGCCGCTTGTTGCAGTAAGCTGAGGGAGCAACAACCGTGCTTTTGTGGGTACCTCAAGAATCCAAGCTTGGGAGGTTACGTGCAATCTCCTCGTGCCAAAACTGTTATTTCCAAATGTGGTGTTCCCTTCCCCAAATGCTAG ATGAAAAAGCTTCCGATCACAAGGCTTTGCCTTTTGGTGGTGACAATGGCCGCGCTCCTAACTGCAGCTCATCTTGCCGAGGCGGTGACTTGCAGCACTATGGAGCTTAGTCCATGCATGGGTGCAATAACGTCGACCGCACCACCGCCGGCCGCTTGTTGCAGTAAGCTGAGGGAGCAACAACCGTGCTTTTGTGGGTACCTCAAGAATCCAAGCTTGGGAGGTTACGTGCAATCTCCTCGTGCCAAAACTGTTATTTCCAAATGTGGTGTTCCCTTCCCCAAATGCTAG ATGAAAAAGCTTCCGATCACAAGGCTTTGCCTTTTGGTGGTGACAATGGCCGCGCTCCTAACTGCAGCTCATCTTGCCGAGGCGGTGACTTGCAGCACTATGGAGCTTAGTCCATGCATGGGTGCAATAACGTCGACCGCACCACCGCCGGCCGCTTGTTGCAGTAAGCTGAGGGAGCAACAACCGTGCTTTTGTGGGTACCTCAAGAATCCAAGCTTGGGAGGTTACGTGCAATCTCCTCGTGCCAAAACTGTTATTTCCAAATGTGGTGTTCCCTTCCCCAAATGCTAG MKKLPITRLCLLVVTMAALLTAAHLAEAVTCSTMELSPCMGAITSTAPPPAACCSKLREQQPCFCGYLKNPSLGGYVQSPRAKTVISKCGVPFPKC
BLAST of Cla97C07G143390 vs. NCBI nr
Match: XP_008444080.1 (PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis melo]) HSP 1 Score: 148.3 bits (373), Expect = 1.3e-32 Identity = 72/96 (75.00%), Postives = 80/96 (83.33%), Query Frame = 0
BLAST of Cla97C07G143390 vs. NCBI nr
Match: KGN53818.1 (hypothetical protein Csa_4G146250 [Cucumis sativus]) HSP 1 Score: 145.6 bits (366), Expect = 8.7e-32 Identity = 70/96 (72.92%), Postives = 80/96 (83.33%), Query Frame = 0
BLAST of Cla97C07G143390 vs. NCBI nr
Match: KGN53816.1 (hypothetical protein Csa_4G141240 [Cucumis sativus]) HSP 1 Score: 144.8 bits (364), Expect = 1.5e-31 Identity = 69/96 (71.88%), Postives = 80/96 (83.33%), Query Frame = 0
BLAST of Cla97C07G143390 vs. NCBI nr
Match: XP_022143278.1 (non-specific lipid-transfer protein 2-like [Momordica charantia]) HSP 1 Score: 130.6 bits (327), Expect = 2.9e-27 Identity = 66/96 (68.75%), Postives = 74/96 (77.08%), Query Frame = 0
BLAST of Cla97C07G143390 vs. NCBI nr
Match: XP_022955426.1 (non-specific lipid-transfer protein 2-like [Cucurbita moschata]) HSP 1 Score: 122.5 bits (306), Expect = 7.9e-25 Identity = 59/96 (61.46%), Postives = 71/96 (73.96%), Query Frame = 0
BLAST of Cla97C07G143390 vs. TrEMBL
Match: tr|A0A1S3B931|A0A1S3B931_CUCME (non-specific lipid-transfer protein 2-like OS=Cucumis melo OX=3656 GN=LOC103487520 PE=4 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 8.9e-33 Identity = 72/96 (75.00%), Postives = 80/96 (83.33%), Query Frame = 0
BLAST of Cla97C07G143390 vs. TrEMBL
Match: tr|A0A0A0KW85|A0A0A0KW85_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G146250 PE=4 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 5.8e-32 Identity = 70/96 (72.92%), Postives = 80/96 (83.33%), Query Frame = 0
BLAST of Cla97C07G143390 vs. TrEMBL
Match: tr|A0A0A0L100|A0A0A0L100_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G141240 PE=4 SV=1) HSP 1 Score: 144.8 bits (364), Expect = 9.9e-32 Identity = 69/96 (71.88%), Postives = 80/96 (83.33%), Query Frame = 0
BLAST of Cla97C07G143390 vs. TrEMBL
Match: tr|A0A2I0JKG2|A0A2I0JKG2_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CRG98_022822 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 2.2e-23 Identity = 55/88 (62.50%), Postives = 64/88 (72.73%), Query Frame = 0
BLAST of Cla97C07G143390 vs. TrEMBL
Match: tr|V4SY21|V4SY21_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10013188mg PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 4.9e-23 Identity = 49/89 (55.06%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of Cla97C07G143390 vs. Swiss-Prot
Match: sp|P82353|NLTP2_PRUAR (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca OX=36596 PE=1 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.8e-20 Identity = 43/68 (63.24%), Postives = 50/68 (73.53%), Query Frame = 0
BLAST of Cla97C07G143390 vs. Swiss-Prot
Match: sp|P86809|NLTP2_APIGA (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum OX=278110 PE=1 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 4.2e-17 Identity = 38/67 (56.72%), Postives = 47/67 (70.15%), Query Frame = 0
BLAST of Cla97C07G143390 vs. Swiss-Prot
Match: sp|P82900|NLT2G_WHEAT (Non-specific lipid-transfer protein 2G OS=Triticum aestivum OX=4565 PE=1 SV=2) HSP 1 Score: 75.9 bits (185), Expect = 2.8e-13 Identity = 40/96 (41.67%), Postives = 53/96 (55.21%), Query Frame = 0
BLAST of Cla97C07G143390 vs. Swiss-Prot
Match: sp|P82901|NLT2P_WHEAT (Non-specific lipid-transfer protein 2P OS=Triticum aestivum OX=4565 PE=1 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.7e-13 Identity = 30/66 (45.45%), Postives = 39/66 (59.09%), Query Frame = 0
BLAST of Cla97C07G143390 vs. Swiss-Prot
Match: sp|A2XBN5|NLTPX_ORYSI (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica OX=39946 GN=LTP-2 PE=3 SV=2) HSP 1 Score: 70.5 bits (171), Expect = 1.2e-11 Identity = 38/96 (39.58%), Postives = 51/96 (53.12%), Query Frame = 0
BLAST of Cla97C07G143390 vs. TAIR10
Match: AT1G48750.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 86.3 bits (212), Expect = 1.1e-17 Identity = 42/86 (48.84%), Postives = 55/86 (63.95%), Query Frame = 0
BLAST of Cla97C07G143390 vs. TAIR10
Match: AT5G38170.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 81.3 bits (199), Expect = 3.7e-16 Identity = 33/68 (48.53%), Postives = 43/68 (63.24%), Query Frame = 0
BLAST of Cla97C07G143390 vs. TAIR10
Match: AT3G18280.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 76.6 bits (187), Expect = 9.1e-15 Identity = 38/96 (39.58%), Postives = 53/96 (55.21%), Query Frame = 0
BLAST of Cla97C07G143390 vs. TAIR10
Match: AT1G66850.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 76.3 bits (186), Expect = 1.2e-14 Identity = 38/99 (38.38%), Postives = 53/99 (53.54%), Query Frame = 0
BLAST of Cla97C07G143390 vs. TAIR10
Match: AT5G38160.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 75.1 bits (183), Expect = 2.6e-14 Identity = 29/68 (42.65%), Postives = 42/68 (61.76%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|