Lsi07G009280 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAATTTTCCTATCACAGTTGTTTGCATTTTTGTGGTGGCGACCACGGTGGCGCTTTTCAACTGCGCTCGTCCGGTGGCTGCTCAGACAACATGCAACCCTTCGCAGCTAGGTATACCATGTGGAGCAGCATTTTTCTCATCGTCGACGCCCAGTCGCGATTGTTGCAATAAGTTGAGGGAGCAACAACCATGCTACTGTACTTATCTCCACGATCCAAATTTGAAGAATTTGGTGGATTCTCCTGCCGCTAAAAGGATTGCTAAAGCCTGCAATATTACCTTCCCAAGTCAGGCTGAGTGCCCTAACTAG ATGAAGAATTTTCCTATCACAGTTGTTTGCATTTTTGTGGTGGCGACCACGGTGGCGCTTTTCAACTGCGCTCGTCCGGTGGCTGCTCAGACAACATGCAACCCTTCGCAGCTAGGTATACCATGTGGAGCAGCATTTTTCTCATCGTCGACGCCCAGTCGCGATTGTTGCAATAAGTTGAGGGAGCAACAACCATGCTACTGTACTTATCTCCACGATCCAAATTTGAAGAATTTGGTGGATTCTCCTGCCGCTAAAAGGATTGCTAAAGCCTGCAATATTACCTTCCCAAGTCAGGCTGAGTGCCCTAACTAG ATGAAGAATTTTCCTATCACAGTTGTTTGCATTTTTGTGGTGGCGACCACGGTGGCGCTTTTCAACTGCGCTCGTCCGGTGGCTGCTCAGACAACATGCAACCCTTCGCAGCTAGGTATACCATGTGGAGCAGCATTTTTCTCATCGTCGACGCCCAGTCGCGATTGTTGCAATAAGTTGAGGGAGCAACAACCATGCTACTGTACTTATCTCCACGATCCAAATTTGAAGAATTTGGTGGATTCTCCTGCCGCTAAAAGGATTGCTAAAGCCTGCAATATTACCTTCCCAAGTCAGGCTGAGTGCCCTAACTAG MKNFPITVVCIFVVATTVALFNCARPVAAQTTCNPSQLGIPCGAAFFSSSTPSRDCCNKLREQQPCYCTYLHDPNLKNLVDSPAAKRIAKACNITFPSQAECPN
BLAST of Lsi07G009280 vs. Swiss-Prot
Match: NLTP_VIGUN (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata PE=2 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.6e-14 Identity = 42/94 (44.68%), Postives = 58/94 (61.70%), Query Frame = 1
BLAST of Lsi07G009280 vs. Swiss-Prot
Match: NLTP2_APIGA (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.3e-13 Identity = 34/63 (53.97%), Postives = 44/63 (69.84%), Query Frame = 1
BLAST of Lsi07G009280 vs. Swiss-Prot
Match: NLTP2_PRUAR (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.2e-10 Identity = 29/66 (43.94%), Postives = 40/66 (60.61%), Query Frame = 1
BLAST of Lsi07G009280 vs. Swiss-Prot
Match: NLT2P_WHEAT (Non-specific lipid-transfer protein 2P OS=Triticum aestivum PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.4e-09 Identity = 26/65 (40.00%), Postives = 36/65 (55.38%), Query Frame = 1
BLAST of Lsi07G009280 vs. Swiss-Prot
Match: NLTP2_HORVU (Probable non-specific lipid-transfer protein OS=Hordeum vulgare GN=LTP2 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.3e-08 Identity = 30/87 (34.48%), Postives = 40/87 (45.98%), Query Frame = 1
BLAST of Lsi07G009280 vs. TrEMBL
Match: A0A0A0KZL4_CUCSA (Putative lipid transfer protein family protein OS=Cucumis sativus GN=Csa_4G146240 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 4.6e-29 Identity = 69/103 (66.99%), Postives = 83/103 (80.58%), Query Frame = 1
BLAST of Lsi07G009280 vs. TrEMBL
Match: S4TID2_GOSHI (Lipid transfer protein OS=Gossypium hirsutum GN=LTP9 PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.8e-15 Identity = 43/92 (46.74%), Postives = 62/92 (67.39%), Query Frame = 1
BLAST of Lsi07G009280 vs. TrEMBL
Match: V4T361_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10013191mg PE=4 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 6.4e-15 Identity = 47/98 (47.96%), Postives = 60/98 (61.22%), Query Frame = 1
BLAST of Lsi07G009280 vs. TrEMBL
Match: A0A0S3T7G1_PHAAN (Uncharacterized protein OS=Vigna angularis var. angularis GN=Vigan.11G005400 PE=4 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 8.4e-15 Identity = 48/97 (49.48%), Postives = 61/97 (62.89%), Query Frame = 1
BLAST of Lsi07G009280 vs. TrEMBL
Match: A0A0D2TTY3_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G057100 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.4e-14 Identity = 43/92 (46.74%), Postives = 57/92 (61.96%), Query Frame = 1
BLAST of Lsi07G009280 vs. TAIR10
Match: AT1G48750.1 (AT1G48750.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 82.8 bits (203), Expect = 1.4e-16 Identity = 42/93 (45.16%), Postives = 56/93 (60.22%), Query Frame = 1
BLAST of Lsi07G009280 vs. TAIR10
Match: AT3G18280.1 (AT3G18280.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 77.8 bits (190), Expect = 4.4e-15 Identity = 37/91 (40.66%), Postives = 56/91 (61.54%), Query Frame = 1
BLAST of Lsi07G009280 vs. TAIR10
Match: AT1G73780.1 (AT1G73780.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 70.1 bits (170), Expect = 9.2e-13 Identity = 39/93 (41.94%), Postives = 52/93 (55.91%), Query Frame = 1
BLAST of Lsi07G009280 vs. TAIR10
Match: AT5G38170.1 (AT5G38170.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 65.9 bits (159), Expect = 1.7e-11 Identity = 28/70 (40.00%), Postives = 38/70 (54.29%), Query Frame = 1
BLAST of Lsi07G009280 vs. TAIR10
Match: AT5G38195.1 (AT5G38195.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 65.5 bits (158), Expect = 2.3e-11 Identity = 35/98 (35.71%), Postives = 59/98 (60.20%), Query Frame = 1
BLAST of Lsi07G009280 vs. NCBI nr
Match: gi|659086711|ref|XP_008444079.1| (PREDICTED: non-specific lipid-transfer protein 2P-like [Cucumis melo]) HSP 1 Score: 137.9 bits (346), Expect = 1.0e-29 Identity = 68/105 (64.76%), Postives = 80/105 (76.19%), Query Frame = 1
BLAST of Lsi07G009280 vs. NCBI nr
Match: gi|778692189|ref|XP_011653423.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis sativus]) HSP 1 Score: 135.2 bits (339), Expect = 6.6e-29 Identity = 69/103 (66.99%), Postives = 83/103 (80.58%), Query Frame = 1
BLAST of Lsi07G009280 vs. NCBI nr
Match: gi|440494829|gb|AGC08429.1| (lipid transfer protein [Gossypium hirsutum]) HSP 1 Score: 89.0 bits (219), Expect = 5.4e-15 Identity = 43/92 (46.74%), Postives = 62/92 (67.39%), Query Frame = 1
BLAST of Lsi07G009280 vs. NCBI nr
Match: gi|567876273|ref|XP_006430726.1| (hypothetical protein CICLE_v10013191mg [Citrus clementina]) HSP 1 Score: 88.2 bits (217), Expect = 9.2e-15 Identity = 47/98 (47.96%), Postives = 60/98 (61.22%), Query Frame = 1
BLAST of Lsi07G009280 vs. NCBI nr
Match: gi|965615765|dbj|BAU00915.1| (hypothetical protein VIGAN_11005400 [Vigna angularis var. angularis]) HSP 1 Score: 87.8 bits (216), Expect = 1.2e-14 Identity = 48/97 (49.48%), Postives = 61/97 (62.89%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|