Cp4.1LG03g15200 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAACTTTGGCATCACAGTTGTTTCCTTTTTCGTGGTGGCGCTTCTCACCGGAGCCCATCAGGTAGGCGCACAGCAGACGTGCGACCCTCAGCTGCTGGCCATTCCATGTGGACTTGCATTCTCTGGCATGAAGCCGTCTACCCGATGCTGCAATAAGGTGAGGGAGCAACAGCCATGCTACTGTGCATACCTCAATAATCCAGATTTGAAGGGTTTTGTGGACTCTCCTGCCGCGAGAAGGATTGCTAGAGACTGCAACATTACGATCCCGACTCAGGCCGAGTGCCCTGCAAGCCCTGCTTAG ATGAAGAACTTTGGCATCACAGTTGTTTCCTTTTTCGTGGTGGCGCTTCTCACCGGAGCCCATCAGGTAGGCGCACAGCAGACGTGCGACCCTCAGCTGCTGGCCATTCCATGTGGACTTGCATTCTCTGGCATGAAGCCGTCTACCCGATGCTGCAATAAGGTGAGGGAGCAACAGCCATGCTACTGTGCATACCTCAATAATCCAGATTTGAAGGGTTTTGTGGACTCTCCTGCCGCGAGAAGGATTGCTAGAGACTGCAACATTACGATCCCGACTCAGGCCGAGTGCCCTGCAAGCCCTGCTTAG ATGAAGAACTTTGGCATCACAGTTGTTTCCTTTTTCGTGGTGGCGCTTCTCACCGGAGCCCATCAGGTAGGCGCACAGCAGACGTGCGACCCTCAGCTGCTGGCCATTCCATGTGGACTTGCATTCTCTGGCATGAAGCCGTCTACCCGATGCTGCAATAAGGTGAGGGAGCAACAGCCATGCTACTGTGCATACCTCAATAATCCAGATTTGAAGGGTTTTGTGGACTCTCCTGCCGCGAGAAGGATTGCTAGAGACTGCAACATTACGATCCCGACTCAGGCCGAGTGCCCTGCAAGCCCTGCTTAG MKNFGITVVSFFVVALLTGAHQVGAQQTCDPQLLAIPCGLAFSGMKPSTRCCNKVREQQPCYCAYLNNPDLKGFVDSPAARRIARDCNITIPTQAECPASPA
BLAST of Cp4.1LG03g15200 vs. Swiss-Prot
Match: NLTP2_PRUAR (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.2e-12 Identity = 30/65 (46.15%), Postives = 41/65 (63.08%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. Swiss-Prot
Match: NLTP_VIGUN (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata PE=2 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 5.5e-12 Identity = 32/87 (36.78%), Postives = 52/87 (59.77%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. Swiss-Prot
Match: NLTP2_HORVU (Probable non-specific lipid-transfer protein OS=Hordeum vulgare GN=LTP2 PE=2 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 4.6e-11 Identity = 34/91 (37.36%), Postives = 44/91 (48.35%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. Swiss-Prot
Match: NLTP2_APIGA (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum PE=1 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.8e-10 Identity = 29/65 (44.62%), Postives = 41/65 (63.08%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. Swiss-Prot
Match: NLT2G_WHEAT (Non-specific lipid-transfer protein 2G OS=Triticum aestivum PE=1 SV=2) HSP 1 Score: 62.0 bits (149), Expect = 4.4e-09 Identity = 27/85 (31.76%), Postives = 40/85 (47.06%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. TrEMBL
Match: A0A0A0KZL4_CUCSA (Putative lipid transfer protein family protein OS=Cucumis sativus GN=Csa_4G146240 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.5e-24 Identity = 62/102 (60.78%), Postives = 73/102 (71.57%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. TrEMBL
Match: U5GFX5_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0005s15210g PE=4 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.4e-14 Identity = 39/93 (41.94%), Postives = 53/93 (56.99%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. TrEMBL
Match: M5WF15_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica GN=PRUPE_ppa025024mg PE=4 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 4.1e-14 Identity = 38/87 (43.68%), Postives = 52/87 (59.77%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. TrEMBL
Match: A0A103Y098_CYNCS (Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain-containing protein OS=Cynara cardunculus var. scolymus GN=Ccrd_021620 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.2e-13 Identity = 37/92 (40.22%), Postives = 58/92 (63.04%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. TrEMBL
Match: A0A067KA29_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_13008 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.0e-13 Identity = 44/96 (45.83%), Postives = 55/96 (57.29%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. TAIR10
Match: AT3G18280.1 (AT3G18280.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 73.6 bits (179), Expect = 8.1e-14 Identity = 37/89 (41.57%), Postives = 51/89 (57.30%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. TAIR10
Match: AT1G48750.1 (AT1G48750.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 72.4 bits (176), Expect = 1.8e-13 Identity = 30/66 (45.45%), Postives = 38/66 (57.58%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. TAIR10
Match: AT1G73780.1 (AT1G73780.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 71.6 bits (174), Expect = 3.1e-13 Identity = 31/83 (37.35%), Postives = 48/83 (57.83%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. TAIR10
Match: AT5G38170.1 (AT5G38170.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 63.9 bits (154), Expect = 6.5e-11 Identity = 26/69 (37.68%), Postives = 38/69 (55.07%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. TAIR10
Match: AT5G38195.1 (AT5G38195.1 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein) HSP 1 Score: 60.8 bits (146), Expect = 5.5e-10 Identity = 36/94 (38.30%), Postives = 53/94 (56.38%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. NCBI nr
Match: gi|778692189|ref|XP_011653423.1| (PREDICTED: non-specific lipid-transfer protein 2-like [Cucumis sativus]) HSP 1 Score: 120.2 bits (300), Expect = 2.2e-24 Identity = 62/102 (60.78%), Postives = 73/102 (71.57%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. NCBI nr
Match: gi|659086711|ref|XP_008444079.1| (PREDICTED: non-specific lipid-transfer protein 2P-like [Cucumis melo]) HSP 1 Score: 100.5 bits (249), Expect = 1.8e-18 Identity = 55/104 (52.88%), Postives = 65/104 (62.50%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. NCBI nr
Match: gi|566171515|ref|XP_006383409.1| (hypothetical protein POPTR_0005s15210g [Populus trichocarpa]) HSP 1 Score: 87.0 bits (214), Expect = 2.0e-14 Identity = 39/93 (41.94%), Postives = 53/93 (56.99%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. NCBI nr
Match: gi|595860310|ref|XP_007211115.1| (hypothetical protein PRUPE_ppa025024mg, partial [Prunus persica]) HSP 1 Score: 85.5 bits (210), Expect = 5.9e-14 Identity = 38/87 (43.68%), Postives = 52/87 (59.77%), Query Frame = 1
BLAST of Cp4.1LG03g15200 vs. NCBI nr
Match: gi|976913922|gb|KVI00161.1| (Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain-containing protein [Cynara cardunculus var. scolymus]) HSP 1 Score: 84.0 bits (206), Expect = 1.7e-13 Identity = 37/92 (40.22%), Postives = 58/92 (63.04%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|