MELO3C007588 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.CACATATTCACACAAATTCCCCCACATCTCTCGAGCCCAAGTTTCCCCTACGTTACTATGAGAAGCATGAGCAAGATTTTCATCGGCTTGATTCTGGTGGTTGCGCTGTTGGACAATGGCGGGTTAGTCATTGTAACAGAAGCCAGGCCATTGGGTCTGATGGGCTCGGGCTCGGCGGCAGCAATAGCTGAAGATTTCTTCGAGGGGCTTTCTTTGGGAGCCATTAAGCAGTCGGGTCCCAGCGCCGGCGGCGATGGTCACAAATTCGTTAACTATGACACGTTTGGTGGTATGAAGGATTCTGGCCCCACACCTGGCGATGGACATAGCCACGTCACCTCCTCACATCACTGAGGATGGACGGTCCAACTGTTCATGAGTTCGTTCTGTCGCAACCCCAATGTAGATTAACTAATAACTTGAAAGGGTTGAAAGCTGTCGATGTTATTATATATTTATTTATTTTGTTCTTTTGTTTGATTTTGTGTCATCATACACATTCTTGGATTTGGTTAAACCATTGAAAACATGTTGAAAAG CACATATTCACACAAATTCCCCCACATCTCTCGAGCCCAAGTTTCCCCTACGTTACTATGAGAAGCATGAGCAAGATTTTCATCGGCTTGATTCTGGTGGTTGCGCTGTTGGACAATGGCGGGTTAGTCATTGTAACAGAAGCCAGGCCATTGGGTCTGATGGGCTCGGGCTCGGCGGCAGCAATAGCTGAAGATTTCTTCGAGGGGCTTTCTTTGGGAGCCATTAAGCAGTCGGGTCCCAGCGCCGGCGGCGATGGTCACAAATTCGTTAACTATGACACGTTTGGTGGTATGAAGGATTCTGGCCCCACACCTGGCGATGGACATAGCCACGTCACCTCCTCACATCACTGAGGATGGACGGTCCAACTGTTCATGAGTTCGTTCTGTCGCAACCCCAATGTAGATTAACTAATAACTTGAAAGGGTTGAAAGCTGTCGATGTTATTATATATTTATTTATTTTGTTCTTTTGTTTGATTTTGTGTCATCATACACATTCTTGGATTTGGTTAAACCATTGAAAACATGTTGAAAAG ATGAGAAGCATGAGCAAGATTTTCATCGGCTTGATTCTGGTGGTTGCGCTGTTGGACAATGGCGGGTTAGTCATTGTAACAGAAGCCAGGCCATTGGGTCTGATGGGCTCGGGCTCGGCGGCAGCAATAGCTGAAGATTTCTTCGAGGGGCTTTCTTTGGGAGCCATTAAGCAGTCGGGTCCCAGCGCCGGCGGCGATGGTCACAAATTCGTTAACTATGACACGTTTGGTGGTATGAAGGATTCTGGCCCCACACCTGGCGATGGACATAGCCACGTCACCTCCTCACATCACTGA MRSMSKIFIGLILVVALLDNGGLVIVTEARPLGLMGSGSAAAIAEDFFEGLSLGAIKQSGPSAGGDGHKFVNYDTFGGMKDSGPTPGDGHSHVTSSHH*
BLAST of MELO3C007588 vs. TrEMBL
Match: A0A0A0KIE2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G491710 PE=4 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 6.1e-39 Identity = 83/100 (83.00%), Postives = 88/100 (88.00%), Query Frame = 1
BLAST of MELO3C007588 vs. TrEMBL
Match: A0A059AZU8_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_H02229 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 3.2e-16 Identity = 48/98 (48.98%), Postives = 71/98 (72.45%), Query Frame = 1
BLAST of MELO3C007588 vs. TrEMBL
Match: A0A059AY97_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_H01292 PE=4 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 8.0e-15 Identity = 50/119 (42.02%), Postives = 72/119 (60.50%), Query Frame = 1
BLAST of MELO3C007588 vs. TrEMBL
Match: A0A059B1H0_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_H02237 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.0e-14 Identity = 49/119 (41.18%), Postives = 72/119 (60.50%), Query Frame = 1
BLAST of MELO3C007588 vs. TrEMBL
Match: A0A059AZV2_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_H02234 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.0e-14 Identity = 49/119 (41.18%), Postives = 72/119 (60.50%), Query Frame = 1
BLAST of MELO3C007588 vs. TAIR10
Match: AT2G23270.1 (AT2G23270.1 unknown protein) HSP 1 Score: 68.9 bits (167), Expect = 1.9e-12 Identity = 42/89 (47.19%), Postives = 55/89 (61.80%), Query Frame = 1
BLAST of MELO3C007588 vs. TAIR10
Match: AT4G37290.1 (AT4G37290.1 unknown protein) HSP 1 Score: 57.8 bits (138), Expect = 4.5e-09 Identity = 39/89 (43.82%), Postives = 52/89 (58.43%), Query Frame = 1
BLAST of MELO3C007588 vs. NCBI nr
Match: gi|659079571|ref|XP_008440327.1| (PREDICTED: uncharacterized protein LOC103484809 [Cucumis melo]) HSP 1 Score: 199.1 bits (505), Expect = 3.5e-48 Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 1
BLAST of MELO3C007588 vs. NCBI nr
Match: gi|700193355|gb|KGN48559.1| (hypothetical protein Csa_6G491710 [Cucumis sativus]) HSP 1 Score: 167.9 bits (424), Expect = 8.7e-39 Identity = 83/100 (83.00%), Postives = 88/100 (88.00%), Query Frame = 1
BLAST of MELO3C007588 vs. NCBI nr
Match: gi|629093492|gb|KCW59487.1| (hypothetical protein EUGRSUZ_H02229 [Eucalyptus grandis]) HSP 1 Score: 92.4 bits (228), Expect = 4.7e-16 Identity = 48/98 (48.98%), Postives = 71/98 (72.45%), Query Frame = 1
BLAST of MELO3C007588 vs. NCBI nr
Match: gi|702453318|ref|XP_010026175.1| (PREDICTED: uncharacterized protein LOC104416483 [Eucalyptus grandis]) HSP 1 Score: 87.8 bits (216), Expect = 1.1e-14 Identity = 50/119 (42.02%), Postives = 72/119 (60.50%), Query Frame = 1
BLAST of MELO3C007588 vs. NCBI nr
Match: gi|629093500|gb|KCW59495.1| (hypothetical protein EUGRSUZ_H02237 [Eucalyptus grandis]) HSP 1 Score: 87.4 bits (215), Expect = 1.5e-14 Identity = 49/119 (41.18%), Postives = 72/119 (60.50%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |