Lsi10G004400 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGATTCGGTTGCTATCTTTGGTTCCTAATGCCAAGCAAATCCTGAAGATTCAGTCAGGATTTACCAAAAACCATTTGGATGTTCCAAAAGGGCATGTGGCAGTTTATGTGGGAGAGATTCAAAGGAAACGGTTCGTGGTTCCGATATCTTACTTAAACCATCCGTCATTCCAGCAACTACTCCGCCATGCTGAAGAAGAGTTTGGTTTCCATCATCCTCAAGGGGGCCTAACAATTCCTTGCAAAGAAGATGCCTTTACTGAACTGACTTCTAGATTGCAAGTATCTTGA ATGGGGATTCGGTTGCTATCTTTGGTTCCTAATGCCAAGCAAATCCTGAAGATTCAGTCAGGATTTACCAAAAACCATTTGGATGTTCCAAAAGGGCATGTGGCAGTTTATGTGGGAGAGATTCAAAGGAAACGGTTCGTGGTTCCGATATCTTACTTAAACCATCCGTCATTCCAGCAACTACTCCGCCATGCTGAAGAAGAGTTTGGTTTCCATCATCCTCAAGGGGGCCTAACAATTCCTTGCAAAGAAGATGCCTTTACTGAACTGACTTCTAGATTGCAAGTATCTTGA ATGGGGATTCGGTTGCTATCTTTGGTTCCTAATGCCAAGCAAATCCTGAAGATTCAGTCAGGATTTACCAAAAACCATTTGGATGTTCCAAAAGGGCATGTGGCAGTTTATGTGGGAGAGATTCAAAGGAAACGGTTCGTGGTTCCGATATCTTACTTAAACCATCCGTCATTCCAGCAACTACTCCGCCATGCTGAAGAAGAGTTTGGTTTCCATCATCCTCAAGGGGGCCTAACAATTCCTTGCAAAGAAGATGCCTTTACTGAACTGACTTCTAGATTGCAAGTATCTTGA MGIRLLSLVPNAKQILKIQSGFTKNHLDVPKGHVAVYVGEIQRKRFVVPISYLNHPSFQQLLRHAEEEFGFHHPQGGLTIPCKEDAFTELTSRLQVS
BLAST of Lsi10G004400 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.5e-22 Identity = 51/79 (64.56%), Postives = 58/79 (73.42%), Query Frame = 1
BLAST of Lsi10G004400 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.5e-22 Identity = 51/79 (64.56%), Postives = 57/79 (72.15%), Query Frame = 1
BLAST of Lsi10G004400 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 3.3e-22 Identity = 52/90 (57.78%), Postives = 63/90 (70.00%), Query Frame = 1
BLAST of Lsi10G004400 vs. Swiss-Prot
Match: SAU19_ARATH (Auxin-responsive protein SAUR19 OS=Arabidopsis thaliana GN=SAUR19 PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 7.3e-22 Identity = 50/79 (63.29%), Postives = 58/79 (73.42%), Query Frame = 1
BLAST of Lsi10G004400 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.1e-21 Identity = 46/66 (69.70%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Lsi10G004400 vs. TrEMBL
Match: A0A0A0LLF1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258700 PE=4 SV=1) HSP 1 Score: 186.0 bits (471), Expect = 2.1e-44 Identity = 89/97 (91.75%), Postives = 93/97 (95.88%), Query Frame = 1
BLAST of Lsi10G004400 vs. TrEMBL
Match: A0A0A0LPI0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258720 PE=4 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 1.5e-42 Identity = 86/97 (88.66%), Postives = 91/97 (93.81%), Query Frame = 1
BLAST of Lsi10G004400 vs. TrEMBL
Match: A0A0A0LIZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258760 PE=4 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 2.0e-42 Identity = 85/97 (87.63%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Lsi10G004400 vs. TrEMBL
Match: A0A0A0LJ99_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258740 PE=4 SV=1) HSP 1 Score: 169.5 bits (428), Expect = 2.0e-39 Identity = 80/97 (82.47%), Postives = 88/97 (90.72%), Query Frame = 1
BLAST of Lsi10G004400 vs. TrEMBL
Match: A0A0A0LJA3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G258790 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 1.7e-38 Identity = 81/97 (83.51%), Postives = 86/97 (88.66%), Query Frame = 1
BLAST of Lsi10G004400 vs. TAIR10
Match: AT2G21210.1 (AT2G21210.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 119.0 bits (297), Expect = 1.6e-27 Identity = 57/98 (58.16%), Postives = 76/98 (77.55%), Query Frame = 1
BLAST of Lsi10G004400 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 117.1 bits (292), Expect = 6.1e-27 Identity = 57/97 (58.76%), Postives = 72/97 (74.23%), Query Frame = 1
BLAST of Lsi10G004400 vs. TAIR10
Match: AT4G34810.1 (AT4G34810.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 113.6 bits (283), Expect = 6.8e-26 Identity = 59/105 (56.19%), Postives = 74/105 (70.48%), Query Frame = 1
BLAST of Lsi10G004400 vs. TAIR10
Match: AT4G34790.1 (AT4G34790.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 111.7 bits (278), Expect = 2.6e-25 Identity = 60/108 (55.56%), Postives = 74/108 (68.52%), Query Frame = 1
BLAST of Lsi10G004400 vs. TAIR10
Match: AT4G34770.1 (AT4G34770.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 108.2 bits (269), Expect = 2.8e-24 Identity = 60/104 (57.69%), Postives = 68/104 (65.38%), Query Frame = 1
BLAST of Lsi10G004400 vs. NCBI nr
Match: gi|778674175|ref|XP_011650154.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 186.0 bits (471), Expect = 3.0e-44 Identity = 89/97 (91.75%), Postives = 93/97 (95.88%), Query Frame = 1
BLAST of Lsi10G004400 vs. NCBI nr
Match: gi|659115596|ref|XP_008457635.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 182.6 bits (462), Expect = 3.4e-43 Identity = 87/97 (89.69%), Postives = 92/97 (94.85%), Query Frame = 1
BLAST of Lsi10G004400 vs. NCBI nr
Match: gi|700206757|gb|KGN61876.1| (hypothetical protein Csa_2G258720 [Cucumis sativus]) HSP 1 Score: 179.9 bits (455), Expect = 2.2e-42 Identity = 86/97 (88.66%), Postives = 91/97 (93.81%), Query Frame = 1
BLAST of Lsi10G004400 vs. NCBI nr
Match: gi|700206761|gb|KGN61880.1| (hypothetical protein Csa_2G258760 [Cucumis sativus]) HSP 1 Score: 179.5 bits (454), Expect = 2.8e-42 Identity = 85/97 (87.63%), Postives = 89/97 (91.75%), Query Frame = 1
BLAST of Lsi10G004400 vs. NCBI nr
Match: gi|659115592|ref|XP_008457632.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 178.7 bits (452), Expect = 4.8e-42 Identity = 86/97 (88.66%), Postives = 91/97 (93.81%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |