Lsi08G002520 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAAGAGCAAATCATTTCCTAAGTACTCATCCTCAACCTCGGGCGAGTTCGGTTTCCAAACCCGATCCAGCTCGTACAATTTCAACGGCCCAACTGCAAAGACAACCGGGTTCTCGACCTCGGCCGATCCCGAGCTCCAAAGGAAGAGAAGAATTGCATCTTATAATGTTTTCAACATGGAAAACAAAGTCAAGTCTAGTGTAAAGAACAGCTTCAAGTGGATCAAAACTAAGTTTAGTGACATTCGCTATGGTTTGTGA ATGGAGAAGAGCAAATCATTTCCTAAGTACTCATCCTCAACCTCGGGCGAGTTCGGTTTCCAAACCCGATCCAGCTCGTACAATTTCAACGGCCCAACTGCAAAGACAACCGGGTTCTCGACCTCGGCCGATCCCGAGCTCCAAAGGAAGAGAAGAATTGCATCTTATAATGTTTTCAACATGGAAAACAAAGTCAAGTCTAGTGTAAAGAACAGCTTCAAGTGGATCAAAACTAAGTTTAGTGACATTCGCTATGGTTTGTGA ATGGAGAAGAGCAAATCATTTCCTAAGTACTCATCCTCAACCTCGGGCGAGTTCGGTTTCCAAACCCGATCCAGCTCGTACAATTTCAACGGCCCAACTGCAAAGACAACCGGGTTCTCGACCTCGGCCGATCCCGAGCTCCAAAGGAAGAGAAGAATTGCATCTTATAATGTTTTCAACATGGAAAACAAAGTCAAGTCTAGTGTAAAGAACAGCTTCAAGTGGATCAAAACTAAGTTTAGTGACATTCGCTATGGTTTGTGA MEKSKSFPKYSSSTSGEFGFQTRSSSYNFNGPTAKTTGFSTSADPELQRKRRIASYNVFNMENKVKSSVKNSFKWIKTKFSDIRYGL
BLAST of Lsi08G002520 vs. TrEMBL
Match: A0A0A0K8Y3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G017090 PE=4 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 1.2e-38 Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of Lsi08G002520 vs. TrEMBL
Match: B9H7V5_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0005s21760g PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 1.7e-29 Identity = 66/87 (75.86%), Postives = 79/87 (90.80%), Query Frame = 1
BLAST of Lsi08G002520 vs. TrEMBL
Match: A0A061FIS9_THECC (Mediator of RNA polymerase II transcription subunit 8 OS=Theobroma cacao GN=TCM_047078 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.5e-28 Identity = 65/87 (74.71%), Postives = 78/87 (89.66%), Query Frame = 1
BLAST of Lsi08G002520 vs. TrEMBL
Match: W9R571_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_023803 PE=4 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.2e-27 Identity = 65/87 (74.71%), Postives = 75/87 (86.21%), Query Frame = 1
BLAST of Lsi08G002520 vs. TrEMBL
Match: A9P994_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0002s06580g PE=2 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.8e-27 Identity = 63/87 (72.41%), Postives = 76/87 (87.36%), Query Frame = 1
BLAST of Lsi08G002520 vs. TAIR10
Match: AT4G09890.1 (AT4G09890.1 Protein of unknown function (DUF3511)) HSP 1 Score: 85.9 bits (211), Expect = 1.4e-17 Identity = 52/93 (55.91%), Postives = 66/93 (70.97%), Query Frame = 1
BLAST of Lsi08G002520 vs. TAIR10
Match: AT5G11970.1 (AT5G11970.1 Protein of unknown function (DUF3511)) HSP 1 Score: 58.9 bits (141), Expect = 1.8e-09 Identity = 23/43 (53.49%), Postives = 35/43 (81.40%), Query Frame = 1
BLAST of Lsi08G002520 vs. TAIR10
Match: AT1G72720.1 (AT1G72720.1 Protein of unknown function (DUF3511)) HSP 1 Score: 53.5 bits (127), Expect = 7.4e-08 Identity = 40/100 (40.00%), Postives = 54/100 (54.00%), Query Frame = 1
BLAST of Lsi08G002520 vs. TAIR10
Match: AT3G05725.1 (AT3G05725.1 Protein of unknown function (DUF3511)) HSP 1 Score: 50.1 bits (118), Expect = 8.2e-07 Identity = 20/44 (45.45%), Postives = 34/44 (77.27%), Query Frame = 1
BLAST of Lsi08G002520 vs. TAIR10
Match: AT3G62640.1 (AT3G62640.1 Protein of unknown function (DUF3511)) HSP 1 Score: 48.9 bits (115), Expect = 1.8e-06 Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
BLAST of Lsi08G002520 vs. NCBI nr
Match: gi|700190689|gb|KGN45893.1| (hypothetical protein Csa_6G017090 [Cucumis sativus]) HSP 1 Score: 166.8 bits (421), Expect = 1.7e-38 Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of Lsi08G002520 vs. NCBI nr
Match: gi|224082498|ref|XP_002306717.1| (hypothetical protein POPTR_0005s21760g [Populus trichocarpa]) HSP 1 Score: 136.3 bits (342), Expect = 2.5e-29 Identity = 66/87 (75.86%), Postives = 79/87 (90.80%), Query Frame = 1
BLAST of Lsi08G002520 vs. NCBI nr
Match: gi|590601066|ref|XP_007019583.1| (Mediator of RNA polymerase II transcription subunit 8 [Theobroma cacao]) HSP 1 Score: 133.3 bits (334), Expect = 2.1e-28 Identity = 65/87 (74.71%), Postives = 78/87 (89.66%), Query Frame = 1
BLAST of Lsi08G002520 vs. NCBI nr
Match: gi|703103187|ref|XP_010097663.1| (hypothetical protein L484_023803 [Morus notabilis]) HSP 1 Score: 130.2 bits (326), Expect = 1.8e-27 Identity = 65/87 (74.71%), Postives = 75/87 (86.21%), Query Frame = 1
BLAST of Lsi08G002520 vs. NCBI nr
Match: gi|567883903|ref|XP_006434510.1| (hypothetical protein CICLE_v10003573mg [Citrus clementina]) HSP 1 Score: 129.0 bits (323), Expect = 3.9e-27 Identity = 63/86 (73.26%), Postives = 77/86 (89.53%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|