Lsi03G000430 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCGAGGTGGTGCTCAACGATCGTCTCGGAAAGAAGGTCCGGGTGAAGTGCAACGAGGACGACACGATCGGCGACTTGAAGAAGCTCGTCGCCGCTCAGACCGGAACCAGGGCCGAGAAGATCAGGATCCAGAAGTGGTACAACATCTACAAGGATCATATCACTCTCAAGGATTACGAGATTCATGACGGCATGGGCCTTGAGCTCTATTACAATTGA ATGATCGAGGTGGTGCTCAACGATCGTCTCGGAAAGAAGGTCCGGGTGAAGTGCAACGAGGACGACACGATCGGCGACTTGAAGAAGCTCGTCGCCGCTCAGACCGGAACCAGGGCCGAGAAGATCAGGATCCAGAAGTGGTACAACATCTACAAGGATCATATCACTCTCAAGGATTACGAGATTCATGACGGCATGGGCCTTGAGCTCTATTACAATTGA ATGATCGAGGTGGTGCTCAACGATCGTCTCGGAAAGAAGGTCCGGGTGAAGTGCAACGAGGACGACACGATCGGCGACTTGAAGAAGCTCGTCGCCGCTCAGACCGGAACCAGGGCCGAGAAGATCAGGATCCAGAAGTGGTACAACATCTACAAGGATCATATCACTCTCAAGGATTACGAGATTCATGACGGCATGGGCCTTGAGCTCTATTACAATTGA MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRAEKIRIQKWYNIYKDHITLKDYEIHDGMGLELYYN
BLAST of Lsi03G000430 vs. Swiss-Prot
Match: UBL5_ARATH (Ubiquitin-like protein 5 OS=Arabidopsis thaliana GN=UBL5 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 3.9e-36 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Lsi03G000430 vs. Swiss-Prot
Match: UBL5_PSAOB (Ubiquitin-like protein 5 OS=Psammomys obesus GN=UBL5 PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.9e-28 Identity = 58/72 (80.56%), Postives = 64/72 (88.89%), Query Frame = 1
BLAST of Lsi03G000430 vs. Swiss-Prot
Match: UBL5_MOUSE (Ubiquitin-like protein 5 OS=Mus musculus GN=Ubl5 PE=1 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.9e-28 Identity = 58/72 (80.56%), Postives = 64/72 (88.89%), Query Frame = 1
BLAST of Lsi03G000430 vs. Swiss-Prot
Match: UBL5_MESAU (Ubiquitin-like protein 5 OS=Mesocricetus auratus GN=UBL5 PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.9e-28 Identity = 58/72 (80.56%), Postives = 64/72 (88.89%), Query Frame = 1
BLAST of Lsi03G000430 vs. Swiss-Prot
Match: UBL5_BOVIN (Ubiquitin-like protein 5 OS=Bos taurus GN=UBL5 PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.9e-28 Identity = 58/72 (80.56%), Postives = 64/72 (88.89%), Query Frame = 1
BLAST of Lsi03G000430 vs. TrEMBL
Match: R0GPM9_9BRAS (Uncharacterized protein OS=Capsella rubella GN=CARUB_v10027479mg PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.0e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Lsi03G000430 vs. TrEMBL
Match: A0A078H902_BRANA (BnaA01g24730D protein OS=Brassica napus GN=BnaA01g24730D PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.0e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Lsi03G000430 vs. TrEMBL
Match: A0A0D3ABK7_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea GN=UBL5 PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.0e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Lsi03G000430 vs. TrEMBL
Match: M4E4Y0_BRARP (Uncharacterized protein OS=Brassica rapa subsp. pekinensis PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.0e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Lsi03G000430 vs. TrEMBL
Match: D7MTG3_ARALL (Ubiquitin family protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_917558 PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.0e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Lsi03G000430 vs. TAIR10
Match: AT5G42300.1 (AT5G42300.1 ubiquitin-like protein 5) HSP 1 Score: 151.4 bits (381), Expect = 2.2e-37 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Lsi03G000430 vs. TAIR10
Match: AT3G45180.1 (AT3G45180.1 Ubiquitin-like superfamily protein) HSP 1 Score: 146.7 bits (369), Expect = 5.4e-36 Identity = 70/73 (95.89%), Postives = 71/73 (97.26%), Query Frame = 1
BLAST of Lsi03G000430 vs. NCBI nr
Match: gi|297791835|ref|XP_002863802.1| (ubiquitin family protein [Arabidopsis lyrata subsp. lyrata]) HSP 1 Score: 152.5 bits (384), Expect = 2.8e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Lsi03G000430 vs. NCBI nr
Match: gi|629085023|gb|KCW51380.1| (hypothetical protein EUGRSUZ_J00924, partial [Eucalyptus grandis]) HSP 1 Score: 151.4 bits (381), Expect = 6.2e-34 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Lsi03G000430 vs. NCBI nr
Match: gi|595839341|ref|XP_007207822.1| (hypothetical protein PRUPE_ppa023849mg [Prunus persica]) HSP 1 Score: 151.4 bits (381), Expect = 6.2e-34 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Lsi03G000430 vs. NCBI nr
Match: gi|15238924|ref|NP_199045.1| (ubiquitin-like protein 5 [Arabidopsis thaliana]) HSP 1 Score: 151.4 bits (381), Expect = 6.2e-34 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 1
BLAST of Lsi03G000430 vs. NCBI nr
Match: gi|586677035|ref|XP_006838813.1| (PREDICTED: ubiquitin-like protein 5 [Amborella trichopoda]) HSP 1 Score: 151.4 bits (381), Expect = 6.2e-34 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|