Cucsa.172090 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGCTCGGTCTCTGTCTCCTCCTACTCGTAGCTGCCATCGCCATCACTCTTCCTGTTGCCTTATGTGATTGGACTCGTGCCTATGGTAACCCCGACTACGCCTTTTGGGGCACGGCTGAACCGGCGACGATAAATGATGTTGATGACAGCAGACGACTACTTTTCCAATATGGATTTGCTTACAAATATCCAAAGAATAAGTATTTGGGTTATGATGCACTTAGGAAGAACAACTCCCCTTGCCGTCATCGTGGACACTCTTATTATGACTGTACGAAGCGCCGAAAGGCCAACCCTTATCGTCGTGGGTGCATCGCTATCACTGGTTGTGCTCGATTCACGGATTAA ATGAAGCTCGGTCTCTGTCTCCTCCTACTCGTAGCTGCCATCGCCATCACTCTTCCTGTTGCCTTATGTGATTGGACTCGTGCCTATGGTAACCCCGACTACGCCTTTTGGGGCACGGCTGAACCGGCGACGATAAATGATGTTGATGACAGCAGACGACTACTTTTCCAATATGGATTTGCTTACAAATATCCAAAGAATAAGTATTTGGGTTATGATGCACTTAGGAAGAACAACTCCCCTTGCCGTCATCGTGGACACTCTTATTATGACTGTACGAAGCGCCGAAAGGCCAACCCTTATCGTCGTGGGTGCATCGCTATCACTGGTTGTGCTCGATTCACGGATTAA ATGAAGCTCGGTCTCTGTCTCCTCCTACTCGTAGCTGCCATCGCCATCACTCTTCCTGTTGCCTTATGTGATTGGACTCGTGCCTATGGTAACCCCGACTACGCCTTTTGGGGCACGGCTGAACCGGCGACGATAAATGATGTTGATGACAGCAGACGACTACTTTTCCAATATGGATTTGCTTACAAATATCCAAAGAATAAGTATTTGGGTTATGATGCACTTAGGAAGAACAACTCCCCTTGCCGTCATCGTGGACACTCTTATTATGACTGTACGAAGCGCCGAAAGGCCAACCCTTATCGTCGTGGGTGCATCGCTATCACTGGTTGTGCTCGATTCACGGATTAA MKLGLCLLLLVAAIAITLPVALCDWTRAYGNPDYAFWGTAEPATINDVDDSRRLLFQYGFAYKYPKNKYLGYDALRKNNSPCRHRGHSYYDCTKRRKANPYRRGCIAITGCARFTD*
BLAST of Cucsa.172090 vs. Swiss-Prot
Match: RLF4_ARATH (Protein RALF-like 4 OS=Arabidopsis thaliana GN=RALFL4 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 6.1e-15 Identity = 47/112 (41.96%), Postives = 64/112 (57.14%), Query Frame = 1
BLAST of Cucsa.172090 vs. Swiss-Prot
Match: RLF19_ARATH (Protein RALF-like 19 OS=Arabidopsis thaliana GN=RALFL19 PE=3 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 6.7e-14 Identity = 45/117 (38.46%), Postives = 60/117 (51.28%), Query Frame = 1
BLAST of Cucsa.172090 vs. Swiss-Prot
Match: RLF23_ARATH (Rapid alkalinization factor 23 OS=Arabidopsis thaliana GN=RALF23 PE=1 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 9.1e-11 Identity = 37/96 (38.54%), Postives = 51/96 (53.12%), Query Frame = 1
BLAST of Cucsa.172090 vs. Swiss-Prot
Match: RLF22_ARATH (Protein RALF-like 22 OS=Arabidopsis thaliana GN=RALFL22 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.6e-10 Identity = 32/67 (47.76%), Postives = 40/67 (59.70%), Query Frame = 1
BLAST of Cucsa.172090 vs. Swiss-Prot
Match: RLF33_ARATH (Protein RALF-like 33 OS=Arabidopsis thaliana GN=RALFL33 PE=2 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.5e-10 Identity = 34/75 (45.33%), Postives = 42/75 (56.00%), Query Frame = 1
BLAST of Cucsa.172090 vs. TrEMBL
Match: A0A0A0KCD7_CUCSA (F3H9.8 protein OS=Cucumis sativus GN=Csa_6G199790 PE=4 SV=1) HSP 1 Score: 252.7 bits (644), Expect = 2.2e-64 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 1
BLAST of Cucsa.172090 vs. TrEMBL
Match: A0A0A0KHU4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G484570 PE=4 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 4.7e-38 Identity = 84/115 (73.04%), Postives = 91/115 (79.13%), Query Frame = 1
BLAST of Cucsa.172090 vs. TrEMBL
Match: A0A078FS15_BRANA (BnaA07g08550D protein OS=Brassica napus GN=BnaA07g08550D PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.8e-14 Identity = 49/116 (42.24%), Postives = 64/116 (55.17%), Query Frame = 1
BLAST of Cucsa.172090 vs. TrEMBL
Match: A0A0D3D6A7_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.8e-13 Identity = 47/114 (41.23%), Postives = 63/114 (55.26%), Query Frame = 1
BLAST of Cucsa.172090 vs. TrEMBL
Match: A0A078E5A8_BRANA (BnaC07g10600D protein OS=Brassica napus GN=BnaC07g10600D PE=4 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 1.8e-13 Identity = 47/114 (41.23%), Postives = 63/114 (55.26%), Query Frame = 1
BLAST of Cucsa.172090 vs. TAIR10
Match: AT1G28270.1 (AT1G28270.1 ralf-like 4) HSP 1 Score: 81.6 bits (200), Expect = 3.4e-16 Identity = 47/112 (41.96%), Postives = 64/112 (57.14%), Query Frame = 1
BLAST of Cucsa.172090 vs. TAIR10
Match: AT2G33775.1 (AT2G33775.1 ralf-like 19) HSP 1 Score: 78.2 bits (191), Expect = 3.8e-15 Identity = 45/117 (38.46%), Postives = 60/117 (51.28%), Query Frame = 1
BLAST of Cucsa.172090 vs. TAIR10
Match: AT3G16570.1 (AT3G16570.1 rapid alkalinization factor 23) HSP 1 Score: 67.8 bits (164), Expect = 5.1e-12 Identity = 37/96 (38.54%), Postives = 51/96 (53.12%), Query Frame = 1
BLAST of Cucsa.172090 vs. TAIR10
Match: AT3G05490.1 (AT3G05490.1 ralf-like 22) HSP 1 Score: 66.2 bits (160), Expect = 1.5e-11 Identity = 32/67 (47.76%), Postives = 40/67 (59.70%), Query Frame = 1
BLAST of Cucsa.172090 vs. TAIR10
Match: AT4G15800.1 (AT4G15800.1 ralf-like 33) HSP 1 Score: 65.5 bits (158), Expect = 2.5e-11 Identity = 34/75 (45.33%), Postives = 42/75 (56.00%), Query Frame = 1
BLAST of Cucsa.172090 vs. NCBI nr
Match: gi|449466199|ref|XP_004150814.1| (PREDICTED: protein RALF-like 4 [Cucumis sativus]) HSP 1 Score: 252.7 bits (644), Expect = 3.2e-64 Identity = 116/116 (100.00%), Postives = 116/116 (100.00%), Query Frame = 1
BLAST of Cucsa.172090 vs. NCBI nr
Match: gi|659080853|ref|XP_008441015.1| (PREDICTED: protein RALF-like 19 [Cucumis melo]) HSP 1 Score: 168.7 bits (426), Expect = 6.0e-39 Identity = 86/117 (73.50%), Postives = 93/117 (79.49%), Query Frame = 1
BLAST of Cucsa.172090 vs. NCBI nr
Match: gi|449461879|ref|XP_004148669.1| (PREDICTED: protein RALF-like 19 [Cucumis sativus]) HSP 1 Score: 165.2 bits (417), Expect = 6.7e-38 Identity = 84/115 (73.04%), Postives = 91/115 (79.13%), Query Frame = 1
BLAST of Cucsa.172090 vs. NCBI nr
Match: gi|674917517|emb|CDY15684.1| (BnaA07g08550D [Brassica napus]) HSP 1 Score: 86.3 bits (212), Expect = 3.9e-14 Identity = 49/116 (42.24%), Postives = 64/116 (55.17%), Query Frame = 1
BLAST of Cucsa.172090 vs. NCBI nr
Match: gi|685329751|ref|XP_009102923.1| (PREDICTED: protein RALF-like 4 [Brassica rapa]) HSP 1 Score: 84.7 bits (208), Expect = 1.1e-13 Identity = 48/114 (42.11%), Postives = 63/114 (55.26%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|