Cucsa.115610 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.CTGAAGGTGGCAGCAGCGGCGAACATATAAACCCTGCAATCAGAAAGAGTGAAGACAAAGTGGTGGACTCTGTGCTCGTTCCTGAACTTTCCAAGCCTCTCACTCCTTATTGCAGGTTCTTTTGATCTCATTCTTTTCCTTTTATTCCTCATTCTCACATGCTTAATTTTGCAAAATGGGAGGAATTATAAATTTTGATCACCTGCATTGTATTATATTTGTTAGTATTTTAAACATGATTGCTATAACGACTGAAATGGAACCTCTTTAAAAGATATATGAGATGTGGTTTGGGTGCAGATGTTGGAGGTCAGGGACATTTCCTCTTTGTGATGGAAGCCATGTTAAGCACAACAAAGCAACTGGAGATAACGTTGGTCCTTTGCTCTTAAAGAAGTAG CTGAAGGTGGCAGCAGCGGCGAACATATAAACCCTGCAATCAGAAAGAGTGAAGACAAAGTGGTGGACTCTGTGCTCGTTCCTGAACTTTCCAAGCCTCTCACTCCTTATTGCAGATGTTGGAGGTCAGGGACATTTCCTCTTTGTGATGGAAGCCATGTTAAGCACAACAAAGCAACTGGAGATAACGTTGGTCCTTTGCTCTTAAAGAAGTAG CTGAAGGTGGCAGCAGCGGCGAACATATAAACCCTGCAATCAGAAAGAGTGAAGACAAAGTGGTGGACTCTGTGCTCGTTCCTGAACTTTCCAAGCCTCTCACTCCTTATTGCAGATGTTGGAGGTCAGGGACATTTCCTCTTTGTGATGGAAGCCATGTTAAGCACAACAAAGCAACTGGAGATAACGTTGGTCCTTTGCTCTTAAAGAAGTAG EGGSSGEHINPAIRKSEDKVVDSVLVPELSKPLTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKK*
BLAST of Cucsa.115610 vs. Swiss-Prot
Match: NEET_ARATH (CDGSH iron-sulfur domain-containing protein NEET OS=Arabidopsis thaliana GN=NEET PE=1 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 1.9e-27 Identity = 58/70 (82.86%), Postives = 61/70 (87.14%), Query Frame = 1
BLAST of Cucsa.115610 vs. Swiss-Prot
Match: CISD2_DANRE (CDGSH iron-sulfur domain-containing protein 2 OS=Danio rerio GN=cisd2 PE=2 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 3.3e-16 Identity = 37/62 (59.68%), Postives = 46/62 (74.19%), Query Frame = 1
BLAST of Cucsa.115610 vs. Swiss-Prot
Match: CID2A_ONCMY (CDGSH iron-sulfur domain-containing protein 2A OS=Oncorhynchus mykiss GN=cisd2a PE=2 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 7.4e-16 Identity = 36/62 (58.06%), Postives = 47/62 (75.81%), Query Frame = 1
BLAST of Cucsa.115610 vs. Swiss-Prot
Match: CISD2_XENTR (CDGSH iron-sulfur domain-containing protein 2 OS=Xenopus tropicalis GN=cisd2 PE=2 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 7.4e-16 Identity = 37/62 (59.68%), Postives = 45/62 (72.58%), Query Frame = 1
BLAST of Cucsa.115610 vs. Swiss-Prot
Match: CID2B_XENLA (CDGSH iron-sulfur domain-containing protein 2B OS=Xenopus laevis GN=cisd2-b PE=2 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 7.4e-16 Identity = 37/62 (59.68%), Postives = 45/62 (72.58%), Query Frame = 1
BLAST of Cucsa.115610 vs. TrEMBL
Match: A0A0A0KL88_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G171700 PE=4 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 3.2e-34 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of Cucsa.115610 vs. TrEMBL
Match: W9S1F7_9ROSA (CDGSH iron-sulfur domain-containing protein 2A OS=Morus notabilis GN=L484_012960 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 1.3e-27 Identity = 59/67 (88.06%), Postives = 63/67 (94.03%), Query Frame = 1
BLAST of Cucsa.115610 vs. TrEMBL
Match: B9R9L9_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1498630 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 3.8e-27 Identity = 58/67 (86.57%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of Cucsa.115610 vs. TrEMBL
Match: A0A067JHV2_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_26204 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 8.5e-27 Identity = 58/67 (86.57%), Postives = 61/67 (91.04%), Query Frame = 1
BLAST of Cucsa.115610 vs. TrEMBL
Match: A0A0B2QX84_GLYSO (CDGSH iron-sulfur domain-containing protein 2 OS=Glycine soja GN=glysoja_014007 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.1e-26 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
BLAST of Cucsa.115610 vs. TAIR10
Match: AT5G51720.1 (AT5G51720.1 2 iron, 2 sulfur cluster binding) HSP 1 Score: 122.5 bits (306), Expect = 1.1e-28 Identity = 58/70 (82.86%), Postives = 61/70 (87.14%), Query Frame = 1
BLAST of Cucsa.115610 vs. NCBI nr
Match: gi|449451930|ref|XP_004143713.1| (PREDICTED: CDGSH iron-sulfur domain-containing protein NEET [Cucumis sativus]) HSP 1 Score: 151.8 bits (382), Expect = 4.6e-34 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 1
BLAST of Cucsa.115610 vs. NCBI nr
Match: gi|659073118|ref|XP_008467263.1| (PREDICTED: CDGSH iron-sulfur domain-containing protein NEET [Cucumis melo]) HSP 1 Score: 142.5 bits (358), Expect = 2.8e-31 Identity = 65/68 (95.59%), Postives = 67/68 (98.53%), Query Frame = 1
BLAST of Cucsa.115610 vs. NCBI nr
Match: gi|703147526|ref|XP_010109084.1| (CDGSH iron-sulfur domain-containing protein 2A [Morus notabilis]) HSP 1 Score: 129.8 bits (325), Expect = 1.9e-27 Identity = 59/67 (88.06%), Postives = 63/67 (94.03%), Query Frame = 1
BLAST of Cucsa.115610 vs. NCBI nr
Match: gi|1012242976|ref|XP_015941397.1| (PREDICTED: CDGSH iron-sulfur domain-containing protein NEET [Arachis duranensis]) HSP 1 Score: 129.8 bits (325), Expect = 1.9e-27 Identity = 60/70 (85.71%), Postives = 63/70 (90.00%), Query Frame = 1
BLAST of Cucsa.115610 vs. NCBI nr
Match: gi|255539659|ref|XP_002510894.1| (PREDICTED: CDGSH iron-sulfur domain-containing protein NEET [Ricinus communis]) HSP 1 Score: 128.3 bits (321), Expect = 5.5e-27 Identity = 58/67 (86.57%), Postives = 62/67 (92.54%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|