Cucsa.103370 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.CTTATGCTGCTCGCCCCACTCCCGCAGCCCCCACAACAATCCCGACTCAGGTAATTAAACTTATCTTAATATCATCTATTAGGTTTCGATAATAATTTAGTATGATATACAGCTTGCATATTTGTAGGGTGCATGGTGTTTTTAATAAAACAAATTTTAATGGTTGTTTATTTTGGCTCTGTAGGAGTTGGCCGAGGAATTAAAACAAAGTGATGGTGAGATGGTGATGGACGAGAATTGCGATGGAGTTGGCGAAGAAGAGTGCTTGATGAGACGAACTCTAGCTGCTCACTTAGATTATGTGTATACACAAAAGCATAAGCCATAG CTTATGCTGCTCGCCCCACTCCCGCAGCCCCCACAACAATCCCGACTCAGGAGTTGGCCGAGGAATTAAAACAAAGTGATGGTGAGATGGTGATGGACGAGAATTGCGATGGAGTTGGCGAAGAAGAGTGCTTGATGAGACGAACTCTAGCTGCTCACTTAGATTATGTGTATACACAAAAGCATAAGCCATAG CTTATGCTGCTCGCCCCACTCCCGCAGCCCCCACAACAATCCCGACTCAGGAGTTGGCCGAGGAATTAAAACAAAGTGATGGTGAGATGGTGATGGACGAGAATTGCGATGGAGTTGGCGAAGAAGAGTGCTTGATGAGACGAACTCTAGCTGCTCACTTAGATTATGTGTATACACAAAAGCATAAGCCATAG YAARPTPAAPTTIPTQELAEELKQSDGEMVMDENCDGVGEEECLMRRTLAAHLDYVYTQKHKP*
BLAST of Cucsa.103370 vs. Swiss-Prot
Match: PSK3_ARATH (Phytosulfokines 3 OS=Arabidopsis thaliana GN=PSK3 PE=2 SV=2) HSP 1 Score: 71.6 bits (174), Expect = 3.4e-12 Identity = 31/63 (49.21%), Postives = 44/63 (69.84%), Query Frame = 1
BLAST of Cucsa.103370 vs. Swiss-Prot
Match: PSK_ASPOF (Phytosulfokines OS=Asparagus officinalis GN=PSK PE=1 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 2.5e-10 Identity = 33/62 (53.23%), Postives = 39/62 (62.90%), Query Frame = 1
BLAST of Cucsa.103370 vs. Swiss-Prot
Match: PSK4_ARATH (Putative phytosulfokines 4 OS=Arabidopsis thaliana GN=PSK4 PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 3.9e-08 Identity = 30/63 (47.62%), Postives = 41/63 (65.08%), Query Frame = 1
BLAST of Cucsa.103370 vs. Swiss-Prot
Match: PSK2_ARATH (Phytosulfokines 2 OS=Arabidopsis thaliana GN=PSK2 PE=2 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 8.8e-08 Identity = 35/66 (53.03%), Postives = 39/66 (59.09%), Query Frame = 1
BLAST of Cucsa.103370 vs. Swiss-Prot
Match: PSK4_ORYSJ (Phytosulfokines 4 OS=Oryza sativa subsp. japonica GN=PSK4 PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.0e-07 Identity = 30/61 (49.18%), Postives = 36/61 (59.02%), Query Frame = 1
BLAST of Cucsa.103370 vs. TrEMBL
Match: A0A0A0KLK0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G495850 PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 6.3e-29 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of Cucsa.103370 vs. TrEMBL
Match: D7U6X7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_00s1328g00020 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.8e-12 Identity = 39/65 (60.00%), Postives = 49/65 (75.38%), Query Frame = 1
BLAST of Cucsa.103370 vs. TrEMBL
Match: A0A061FFM9_THECC (Phytosulfokines 3, putative OS=Theobroma cacao GN=TCM_034667 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 4.1e-12 Identity = 38/63 (60.32%), Postives = 46/63 (73.02%), Query Frame = 1
BLAST of Cucsa.103370 vs. TrEMBL
Match: B9SH34_RICCO (Phytosulfokines, putative OS=Ricinus communis GN=RCOM_0581720 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 7.0e-12 Identity = 34/64 (53.12%), Postives = 49/64 (76.56%), Query Frame = 1
BLAST of Cucsa.103370 vs. TrEMBL
Match: B9HFY9_POPTR (Phytosulfokines 3 family protein OS=Populus trichocarpa GN=POPTR_0007s14750g PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 9.1e-12 Identity = 37/63 (58.73%), Postives = 44/63 (69.84%), Query Frame = 1
BLAST of Cucsa.103370 vs. TAIR10
Match: AT3G49780.1 (AT3G49780.1 phytosulfokine 4 precursor) HSP 1 Score: 71.6 bits (174), Expect = 1.9e-13 Identity = 31/63 (49.21%), Postives = 44/63 (69.84%), Query Frame = 1
BLAST of Cucsa.103370 vs. TAIR10
Match: AT4G37720.1 (AT4G37720.1 phytosulfokine 6 precursor) HSP 1 Score: 58.2 bits (139), Expect = 2.2e-09 Identity = 30/63 (47.62%), Postives = 41/63 (65.08%), Query Frame = 1
BLAST of Cucsa.103370 vs. TAIR10
Match: AT2G22860.1 (AT2G22860.1 phytosulfokine 2 precursor) HSP 1 Score: 57.0 bits (136), Expect = 4.9e-09 Identity = 35/66 (53.03%), Postives = 39/66 (59.09%), Query Frame = 1
BLAST of Cucsa.103370 vs. TAIR10
Match: AT5G65870.1 (AT5G65870.1 phytosulfokine 5 precursor) HSP 1 Score: 54.3 bits (129), Expect = 3.2e-08 Identity = 29/56 (51.79%), Postives = 40/56 (71.43%), Query Frame = 1
BLAST of Cucsa.103370 vs. NCBI nr
Match: gi|700193427|gb|KGN48631.1| (hypothetical protein Csa_6G495850 [Cucumis sativus]) HSP 1 Score: 134.0 bits (336), Expect = 9.0e-29 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 1
BLAST of Cucsa.103370 vs. NCBI nr
Match: gi|659079751|ref|XP_008440424.1| (PREDICTED: phytosulfokines 3 [Cucumis melo]) HSP 1 Score: 112.8 bits (281), Expect = 2.2e-22 Identity = 55/63 (87.30%), Postives = 56/63 (88.89%), Query Frame = 1
BLAST of Cucsa.103370 vs. NCBI nr
Match: gi|225467412|ref|XP_002271337.1| (PREDICTED: phytosulfokines 3 [Vitis vinifera]) HSP 1 Score: 79.3 bits (194), Expect = 2.6e-12 Identity = 39/65 (60.00%), Postives = 49/65 (75.38%), Query Frame = 1
BLAST of Cucsa.103370 vs. NCBI nr
Match: gi|743862167|ref|XP_011031319.1| (PREDICTED: phytosulfokines 3-like [Populus euphratica]) HSP 1 Score: 79.0 bits (193), Expect = 3.4e-12 Identity = 38/63 (60.32%), Postives = 45/63 (71.43%), Query Frame = 1
BLAST of Cucsa.103370 vs. NCBI nr
Match: gi|590596860|ref|XP_007018453.1| (Phytosulfokines 3 precursor, putative [Theobroma cacao]) HSP 1 Score: 78.2 bits (191), Expect = 5.9e-12 Identity = 38/63 (60.32%), Postives = 46/63 (73.02%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |